Log in

View Full Version : Clubdom.com videos



Pages : 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 [30] 31 32 33 34 35

Clit
02-03-2025, 12:04 AM
Clubdom.com- Dava & Kylie StrapOn Smoking
https://img166.imagetwist.com/th/67065/wdr4nno08zd0.jpg (https://imagetwist.com/wdr4nno08zd0/tzElIUcG.jpg)
https://img34.imagetwist.com/th/67066/1vzyffkc8vk1.jpg (https://imagetwist.com/1vzyffkc8vk1/WuwtJB.jpg)

Description:
ClubDom, In Our World Women Rule. Mistress Cheyenne has got her slave by the balls and isn_t going to let him off easy It_s ball busting time In Our World ..
Model:
Dava Foxx, Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : s623davakyliestraponsmoking.mp4
File Size : 728.51 MB
Resolution : 1920x1080
Duration : 00:08:26

Download K2S VIDEO:
Keep2Share Video: s623davakyliestraponsmoking.mp4 (https://k2s.cc/file/07f10558e8842)

Clit
02-03-2025, 12:26 AM
Clubdom.com- Anna Lee Brat Dildo Tease
https://img34.imagetwist.com/th/67094/lmby7ml6d29k.jpg (https://imagetwist.com/lmby7ml6d29k/VdoFGtdJ.jpg)
https://img166.imagetwist.com/th/67094/r9u2uaq4yfdu.jpg (https://imagetwist.com/r9u2uaq4yfdu/WEMyXH.jpg)

Description:
Bratty Dom Anna Lee is using her pathetic fuck boy for her own amusement, she has made him already fuck her young wet pussy with a chindo, and he failed to make her cum, So now she has dragged him out of his cage and straddles his chest and makes him watch close up as she masturbates with her big black vibrator, Letting him taste her nectar as she shoves it in his mouth after she has reached orgasm, Then tells him that_s how it_s done now beg me to fuck your boy pussy.
Model:
Anna Lee
Studio:
Clubdom.com
Info:
File Name : s7692-3annaleebratdildotease.mp4
File Size : 464.75 MB
Resolution : 1920x1080
Duration : 00:05:22

Download K2S VIDEO:
Keep2Share Video: s7692-3annaleebratdildotease.mp4 (https://k2s.cc/file/95aa13069ddd2)

Clit
02-03-2025, 12:47 AM
Clubdom.com- Alexis Fawx & Dava Foxx POV1
https://img34.imagetwist.com/th/67118/vlv5t1wlm0rp.jpg (https://imagetwist.com/vlv5t1wlm0rp/YAHakWz.jpg)
https://img202.imagetwist.com/th/67118/tadfogveqecn.jpg (https://imagetwist.com/tadfogveqecn/drzbkX.jpg)

Description:
Dava sees that little worm of yours growing and your hands reaching to touch it. Alexis gets a laugh out of seeing you touch it so she tells you to go ahead and stroke it. Your tiny little dicklet, Loser, can_t do anything but be touched by your own hands. So keep playing with your sissy-stick, because no woman would have use for that tiny slut-stick.... thats why Your mistresses will let you watch them and tell you how to spill your own filth But no one wants to see that nastiness, so you have to lick it up, of course.
Model:
Alexis Fawx, Dava Foxx
Studio:
Clubdom.com
Info:
File Name : s820alexisfawxdavafoxxpov1.mp4
File Size : 561.36 MB
Resolution : 1920x1080
Duration : 00:06:29

Download K2S VIDEO:
Keep2Share Video: s820alexisfawxdavafoxxpov1.mp4 (https://k2s.cc/file/ffb83ff9974e2)

Clit
02-03-2025, 12:51 AM
Clubdom.com- Edged and Fed in The 7 Gates of Hell
https://img166.imagetwist.com/th/67055/17diptqap52z.jpg (https://imagetwist.com/17diptqap52z/DrvNwgX.jpg)
https://s10.imagetwist.com/th/67055/972eah0317zz.jpg (https://imagetwist.com/972eah0317zz/LzgbAGg.jpg)

Description:
Mistress Esmi Lee, Goddess Dava Foxx and Mistress Molly Jane like playing games with their slaves. They have this bitch locked up in the seven gates of hell restricting has pathetic slut stick as they tease him with a vibrator. Slowly stroking his cock with their black gloved hands bringing him right to the brink and slowly spitting on his cock, stroking it fast and then slow. Just playing games with this bitch working his slut stick right to the edge where his balls are about to explode and then stopping and just laughing at him as he begs for release. Masturbation games can be fun don_t you think slave? Finally they make the bitch beg to be fed his own cum please feed me my man filth Goddess. The slave then explodes a thick white load of disgusting filth into Goddess Esmi_s hand. The ladies fishhook the _ mouth wide-open and wipe every last disgusting drop of goo into the bitches mouth.
Model:
Dava Foxx, Esmi Lee, Molly Jane
Studio:
Clubdom.com
Info:
File Name : s596davafoxxesmileemollyjane7gatesofhellhj.mp4
File Size : 724.8 MB
Resolution : 1920x1080
Duration : 00:08:16

Download K2S VIDEO:
Keep2Share Video: s596davafoxxesmileemollyjane7gatesofhellhj.mp4 (https://k2s.cc/file/b65313f0cc79b)

Clit
02-03-2025, 01:27 AM
Clubdom.com- Daisy Ducati & Raven Bay Foot POV
https://img202.imagetwist.com/th/67117/vobkyr26lf6e.jpg (https://imagetwist.com/vobkyr26lf6e/OGXDfpp.jpg)
https://img166.imagetwist.com/th/67117/rflc17kw75fy.jpg (https://imagetwist.com/rflc17kw75fy/kBXGvMb.jpg)

Description:
Goddess Daisy Ducati and Raven Bay are lounging by the pool and notice you staring at their feet, they decide to have some fun with you talking to you and giving you jerk off instruction as they tell you just what a little foot slut you are and how they completely dominate you with their perfectly manicured feet, That_s right foot slut you dream of licking and smelling your Goddess_s beautiful feet as you stroke that tiny 2 inch dicklet of yours spraying your man goo all over your Mistress_s feet and then licking up every last drop foot boy.
Model:
Daisy Ducati, Raven Bay
Studio:
Clubdom.com
Info:
File Name : s808daisyducatiravenbayfootpov.mp4
File Size : 905.04 MB
Resolution : 1920x1080
Duration : 00:10:27

Download K2S VIDEO:
Keep2Share Video: s808daisyducatiravenbayfootpov.mp4 (https://k2s.cc/file/334054496adf2)

Clit
02-03-2025, 01:35 AM
Clubdom.com- Sasha & Elena Milking Slut 1027
https://img34.imagetwist.com/th/67056/3j98uekxgaam.jpg (https://imagetwist.com/3j98uekxgaam/ZqdKiUI.jpg)
https://img119.imagetwist.com/th/67056/4744r7v5y7yr.jpg (https://imagetwist.com/4744r7v5y7yr/pLyJTlQ.jpg)

Description:
Time to milk another slut on the ClubDom Estate. Mistress Sasha Meow and Elena Sin pull every last drop of filth from their slaves worthless nut sacks. Stroking his pathetic 2_ dicklett until his balls are ready to explode. They enjoy his cries. He almost had an orgasm as soon as we walked into the room laughs Elena.
Model:
Elena Sin, Sasha Meow
Studio:
Clubdom.com
Info:
File Name : s603sashameowelenasinhj.mp4
File Size : 696.16 MB
Resolution : 1920x1080
Duration : 00:08:02

Download K2S VIDEO:
Keep2Share Video: s603sashameowelenasinhj.mp4 (https://k2s.cc/file/350b9e0f914af)

Clit
02-03-2025, 01:42 AM
Clubdom.com- Cruel Women, Crueler Games- Charley & Callie
https://s10.imagetwist.com/th/67101/mn1h37dm7ynb.jpg (https://imagetwist.com/mn1h37dm7ynb/eZMznV.jpg)
https://img119.imagetwist.com/th/67101/d3g3xawg9edc.jpg (https://imagetwist.com/d3g3xawg9edc/JtyUcrb.jpg)

Description:
These two incredible Goddesses have a game in mind. The slaves have to race each other around in a circle three times. Whoever looses gets a little bit less pain. They ensure the slaves that they are both going to get it regardless while they laugh Round and round the slaves go and of course one of them loses. Guess he is getting shocked really badly . The women laugh as they continue to torment them. These men only exist to serve their Mistresses, no matter how cruel their treatment. The women get bored and decide they have another game in store. Mistress Kelly and her friend give their restrained slave 20 seconds to jerk off unless she fries his balls with the cattle prod. What of the other slave? He cannot just stand there. They decide to clean off his useless fuck stick with water making him even more conductive to the electricity and give him a choice at which ball they should shock.
The girls go back to slave 1 bound on the table and decide to milk his slut-stick and are so unhappy with what he produces. They decide to save it to put on their dildo for when they fuck his man pussy later.
Model:
Callie Nicole, Charley Hart
Studio:
Clubdom.com
Info:
File Name : s7952-3milking.mp4
File Size : 453.77 MB
Resolution : 1920x1080
Duration : 00:05:15

Download K2S VIDEO:
Keep2Share Video: s7952-3milking.mp4 (https://k2s.cc/file/038432aaf3e83)

Clit
02-03-2025, 01:57 AM
Clubdom.com- Michelle Lacy & Brianna Milking Bitch
https://img34.imagetwist.com/th/67054/31debpty0y0a.jpg (https://imagetwist.com/31debpty0y0a/TJfosT.jpg)
https://img401.imagetwist.com/th/67054/7cqlgizlp6ia.jpg (https://imagetwist.com/7cqlgizlp6ia/PKtfFw.jpg)

Description:
It_s time to milk another bitch Goddess Brianna and Mistress Michelle Lacy decide it_s time to pull the man filth right out of this slut. He_s looking weak, like he_s lacking protein. Goddess Brianna edges him right to the brink of insanity driving him crazy. Slowly stroking his cock. Stroking it really fast then letting go. The ladies are amused and laugh at his suffering. Making him beg for it. Finally Brianna says you_re going to have to work for it bitch. That_s it fuck my hand, fuck it. You do the work bitch Disgusting filth starts squirting out of his slut stick. Squirt after squirt. This bitch will be eating well tonight.
Model:
Goddess Brianna, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s584_michelle_lacy_brianna_milking_bitch.mp4
File Size : 606.06 MB
Resolution : 1920x1080
Duration : 00:07:01

Download K2S VIDEO:
Keep2Share Video: s584_michelle_lacy_brianna_milking_bitch.mp4 (https://k2s.cc/file/033d00e159f07)

Clit
02-03-2025, 02:10 AM
Clubdom.com- Esmi & Nataila Caning
https://s10.imagetwist.com/th/67053/tvihyca74zto.jpg (https://imagetwist.com/tvihyca74zto/KXqsxw.jpg)
https://s10.imagetwist.com/th/67053/up65q432mf5u.jpg (https://imagetwist.com/up65q432mf5u/PTSUXhu.jpg)

Description:
ClubDom, In Our World Women Rule. Mistress Cheyenne has got her slave by the balls and isn_t going to let him off easy It_s ball busting time In Our World ..
Model:
Esmi Lee
Studio:
Clubdom.com
Info:
File Name : s575esminatalianatashacaning.mp4
File Size : 612.67 MB
Resolution : 1920x1080
Duration : 00:07:06

Download K2S VIDEO:
Keep2Share Video: s575esminatalianatashacaning.mp4 (https://k2s.cc/file/375d23f5b449c)

Clit
02-03-2025, 02:26 AM
Clubdom.com- Cherry & Kylie Anal Ripping Their Sluts
https://img166.imagetwist.com/th/67095/sabskpxgbho2.jpg (https://imagetwist.com/sabskpxgbho2/hNVvRS.jpg)
https://img119.imagetwist.com/th/67095/hcif0c9ovio1.jpg (https://imagetwist.com/hcif0c9ovio1/GvACXaP.jpg)

Description:
Brat Doms Kylie Rogue and Cherry morgan are all decked out in their school girl outfits, add hot pink and black thigh high boots and gloves, Oh and don_t forget the 13 strap on cocks they are wearing either, They pull some slutty boys from their cage and tell them lube them up good boys because it_s time for some anal ripping fun, Goddess cherry shoves her huge pink cock down slut boys throat as he gags and drips spit everywhere Goddess Kylie takes her bitch slow talking dirty telling him how much he will love his gaping asshole after she is through pounding and ripping it open, the girls fuck these boys hard and stretch out their gaping assholes as far as they will go in every position possible making them beg for every inch of hard cock.
Model:
Cherry Morgan, Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : s764cherrymorgankylieroguedoublestrapon.mp4
File Size : 503.11 MB
Resolution : 1920x1080
Duration : 00:05:51

Download K2S VIDEO:
Keep2Share Video: s764cherrymorgankylieroguedoublestrapon.mp4 (https://k2s.cc/file/3af6613a09ead)

Clit
02-03-2025, 02:35 AM
Clubdom.com- Kylie Rogue & Michelle Lacy CBT
https://img401.imagetwist.com/th/67119/ihdi2pe24alu.jpg (https://imagetwist.com/ihdi2pe24alu/aqbXCx.jpg)
https://img34.imagetwist.com/th/67119/qhgc88l6yujj.jpg (https://imagetwist.com/qhgc88l6yujj/qvsEPRq.jpg)

Description:
Goddess Michelle has her slave mummified and in his chastity. He can_t move an inch or even beg with his mouth stretched wide. Michelle has deliciously devious plans with a vibrator she is pulling out. Kylie Rogue admires the fan of pins clamping down on the slaves filth sacks and is excited to watch Michelle tease this bitch through chastity until he spills. Smoking and ashing all over his dicklet, The vibration quickly forces the _tick to swell up and with total control of each sensation, Michelle forces the slave to coat the inside of his chastity with his filth spurting out. But look at that sluthole stretched wide let_s fill it with some of this protein we can scoop up mixed with the ash from Michelle_s cigarette.
Model:
Kylie Rogue, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s848kylieroguemichellelacycbt.mp4
File Size : 658.34 MB
Resolution : 1920x1080
Duration : 00:07:31

Download K2S VIDEO:
Keep2Share Video: s848kylieroguemichellelacycbt.mp4 (https://k2s.cc/file/20caa9da7a036)

Clit
02-03-2025, 02:46 AM
Clubdom.com- Alexis & Dava Need Roadside Assistance P2
https://img69.imagetwist.com/th/67114/npa005imuojr.jpg (https://imagetwist.com/npa005imuojr/WBYDqbQT.jpg)
https://img119.imagetwist.com/th/67114/xhb65jl5b6k3.jpg (https://imagetwist.com/xhb65jl5b6k3/cUOytxHu.jpg)

Description:
ClubDom, In Our World Women Rule. Mistress Cheyenne has got her slave by the balls and isn_t going to let him off easy It_s ball busting time In Our World ..
Model:
Alexis Fawx, Dava Foxx
Studio:
Clubdom.com
Info:
File Name : s8132-2alexisfawxdavafoxxbg.mp4
File Size : 695.43 MB
Resolution : 1920x1080
Duration : 00:08:07

Download K2S VIDEO:
Keep2Share Video: s8132-2alexisfawxdavafoxxbg.mp4 (https://k2s.cc/file/34aa60deba751)

Clit
02-03-2025, 02:50 AM
Clubdom.com- Kylie Rogue & Jamie Strapon Sucking
https://img119.imagetwist.com/th/67057/wlas5q7bt4oj.jpg (https://imagetwist.com/wlas5q7bt4oj/exDBXS.jpg)
https://img166.imagetwist.com/th/67057/oc1774uvcfbv.jpg (https://imagetwist.com/oc1774uvcfbv/YawbMRNN.jpg)

Description:
Goddess Jamie Valentine and Mistress Kylie Rogue decide it_s time to fuck some man pussy. They pull their blind folded slave out of his cage and instruct him to open his slutty mouth. They proceed to fill it with 12 inches of black hard cock. Informing him that this is the lube that they will be using to stretch open his pussy hole. Look at this pathetic drool. Thats right bitch lube it up good. He is restrained and bent over and both take turns stretching out his gaping man pussy. Jamie gives the bitch a ride. Slapping his ass as she pounds him over and over. Then Goddess Kylie takes a turn wearing out his slutty ass. Filling it to its maximum capacity. Jamie comments so far up his ass I think he_s choking on it. The ladies high five each other laughing and continue to pound away.
Model:
Jamie Valentine, Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : s611kylieroguejamievalentinestrapon.mp4
File Size : 615.31 MB
Resolution : 1920x1080
Duration : 00:07:04

Download K2S VIDEO:
Keep2Share Video: s611kylieroguejamievalentinestrapon.mp4 (https://k2s.cc/file/4d0958b2b0c61)

Clit
02-03-2025, 03:10 AM
Clubdom.com- Alexis Fawx_s Human Dildo
https://img401.imagetwist.com/th/67114/xn9glaggch30.jpg (https://imagetwist.com/xn9glaggch30/irecBl.jpg)
https://img401.imagetwist.com/th/67115/bsri438vzo65.jpg (https://imagetwist.com/bsri438vzo65/rFXAuuWG.jpg)

Description:
Alexis Fawx wants to get off today so she has her slave stick out his tongue and fucks it, since she_s not satisfied she orders him to lay down so she can smother his face and use her human dildo. when His tongue can_t do the job she straddles his slut stick so she can use him like the toy he is. She rides her dildo while taunting him and brings herself to orgasm. Pleasuring herself by using her human toy only made Alexis want to drag him into his cage, After all He has to think about how to better please her, you pathetic loser.
Model:
Alexis Fawx
Studio:
Clubdom.com
Info:
File Name : s816alexisfawxdavafoxxhumandildo.mp4
File Size : 588.39 MB
Resolution : 1920x1080
Duration : 00:06:46

Download K2S VIDEO:
Keep2Share Video: s816alexisfawxdavafoxxhumandildo.mp4 (https://k2s.cc/file/31acd896ec2dd)

Clit
02-03-2025, 03:18 AM
Clubdom.com- Tiny Cock Humiliation by Kylie and Nikki
https://img202.imagetwist.com/th/67078/ynuv2rop9nas.jpg (https://imagetwist.com/ynuv2rop9nas/dtCNxQ.jpg)
https://img202.imagetwist.com/th/67078/kbrp1ledcf28.jpg (https://imagetwist.com/kbrp1ledcf28/ThztLq.jpg)

Description:
Kylie and Nikki are laughing at how small and pathetic your little penis is. They show you how small you are compared to the big dick they have. You must stroke your tiny pathetic cock exactly the way they tell you to. They laugh as you try so hard to make it look bigger. Show them how tiny you are and how you stroke it.
Model:
Kylie Rogue, Nikki Ortega
Studio:
Clubdom.com
Info:
File Name : s655kylieroguenikkiortagapov.mp4
File Size : 566.07 MB
Resolution : 1920x1080
Duration : 00:06:34

Download K2S VIDEO:
Keep2Share Video: s655kylieroguenikkiortagapov.mp4 (https://k2s.cc/file/ecd3d68995245)

Clit
02-03-2025, 04:12 AM
Clubdom.com- Kylie Rogue & Nikki Boot Worship
https://img119.imagetwist.com/th/67071/cpnj75kjcgah.jpg (https://imagetwist.com/cpnj75kjcgah/stNZwhw.jpg)
https://img69.imagetwist.com/th/67071/9z4ttulcj1nv.jpg (https://imagetwist.com/9z4ttulcj1nv/OMMzyMWa.jpg)

Description:
Goddess Nikki Ortega and Mistress Kylie Rouge torment their slaves teasing these pathetic boot bitches Kylie spreads Nikki_s wet pink Pussy right in the slaves face only letting him look and smell. Then instruct both these slut puppy_s to lick and worship their boots while the Goddess_s make out and rub each others hot pink pussies , laughing as they know theses boot _ have never tasted a woman only licked off the filth from their shiny black stiletto boots.
Model:
Kylie Rogue, Nikki Ortega
Studio:
Clubdom.com
Info:
File Name : s652kylieroguenikkiortagabootworship.mp4
File Size : 729.04 MB
Resolution : 1920x1080
Duration : 00:08:25

Download K2S VIDEO:
Keep2Share Video: s652kylieroguenikkiortagabootworship.mp4 (https://k2s.cc/file/257a565f1bfdb)

Clit
02-03-2025, 05:10 AM
Clubdom.com- Pony Cart Race at ClubDom
https://img119.imagetwist.com/th/67055/4mmqpao47gv7.jpg (https://imagetwist.com/4mmqpao47gv7/DLsOdkH.jpg)
https://s10.imagetwist.com/th/67055/6i4vrd8awuvi.jpg (https://imagetwist.com/6i4vrd8awuvi/VaEpmdJ.jpg)

Description:
Another beautiful day on the ClubDom Estate as Goddess Brianna and Mistress Michelle Lacy are having their boots worshiped. To have a little more fun they tell the boys it_s time for a pony cart race. The winner gets three minutes of sniffing and kissing each of the Goddess_s ass. The looser gets a face smacking session and thrown back in the cage for the rest of the day. Slave Bart gives it his best. But slave Alex defeats him easily. Bart has let his Goddess down and must watch as Alex gets to bask in the glory of the Goddess_s beautiful asses. Bart then gets his face smacking and thrown back in the cage.
Model:
Goddess Brianna, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s585michellelacybriannaponycartrace.mp4
File Size : 537.11 MB
Resolution : 1920x1080
Duration : 00:06:12

Download K2S VIDEO:
Keep2Share Video: s585michellelacybriannaponycartrace.mp4 (https://k2s.cc/file/46a505511f987)

Clit
02-03-2025, 05:17 AM
Clubdom.com- Kylie Rogue & Michelle Lacy StrapOn 2
https://img69.imagetwist.com/th/67119/hzlvuxua5e4p.jpg (https://imagetwist.com/hzlvuxua5e4p/uPBFTql.jpg)
https://img119.imagetwist.com/th/67119/zwdtfmwsfhx3.jpg (https://imagetwist.com/zwdtfmwsfhx3/ytjPbsgK.jpg)

Description:
Mistress Michelle Lacy wheels her slave onto the dungeon than rams her 12 inch black strap on cock down the bitches throat before driving every inch of it into his man pussy as he begs for mercy she starts to slap the slaves slutty balls as she laughs and ass fucks him even harder and deeper.
Model:
Kylie Rogue, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s854kylieroguemichellelacystrapon2.mp4
File Size : 533.59 MB
Resolution : 1920x1080
Duration : 00:06:09

Download K2S VIDEO:
Keep2Share Video: s854kylieroguemichellelacystrapon2.mp4 (https://k2s.cc/file/c158c1cdbcf16)

Clit
02-03-2025, 05:31 AM
Clubdom.com- Kylie & Nikki- Femdom Cock-Contest
https://img69.imagetwist.com/th/67079/lsing3bq3j01.jpg (https://imagetwist.com/lsing3bq3j01/OqbgoDjI.jpg)
https://img69.imagetwist.com/th/67079/zhz2zmlbc2yy.jpg (https://imagetwist.com/zhz2zmlbc2yy/NmXOMC.jpg)

Description:
Kylie and Nikki found two lucky guys to be volunteers for their little game. Nikki makes a bet that she can fuck her bitch faster and harder than Kylie. Kylie is up for the challenge as she knows she has a good chance at possibly beating Nikki. The two fuck their slaves in both of their pathetic holes, in and out, faster and faster. They are laughing and having fun at the expense of the men who are violated and fucked over and over for the women. Who will win?
Model:
Kylie Rogue, Nikki Ortega
Studio:
Clubdom.com
Info:
File Name : s658kylieroguenikkiortagastrapon.mp4
File Size : 547.32 MB
Resolution : 1920x1080
Duration : 00:06:23

Download K2S VIDEO:
Keep2Share Video: s658kylieroguenikkiortagastrapon.mp4 (https://k2s.cc/file/a0e83e0f5b29a)

Clit
02-03-2025, 05:49 AM
Clubdom.com- Lydia Supervises Your SissyClitty_s Milking
https://img34.imagetwist.com/th/67119/zhl0s3dqp0xj.jpg (https://imagetwist.com/zhl0s3dqp0xj/roHGbSC.jpg)
https://img69.imagetwist.com/th/67119/33w2ubfclucs.jpg (https://imagetwist.com/33w2ubfclucs/dYVLjJhg.jpg)

Description:
Lydia Supremacy wants to see you really get into it, use your fingers and stroke that small cock. Kylie rogue teases and taunts you but tells you that you are only to spill any filth at all at the very end of their instructions. Lydia is feeling generous today so she even spits on your slut hole for you to fuck it hard while they count you down to spilling.
Model:
Kylie Rogue, Lydia Supremacy
Studio:
Clubdom.com
Info:
File Name : s843lydiasupremacykylieroguepov.mp4
File Size : 493.14 MB
Resolution : 1920x1080
Duration : 00:05:51

Download K2S VIDEO:
Keep2Share Video: s843lydiasupremacykylieroguepov.mp4 (https://k2s.cc/file/3da4d8f549bdb)

Clit
02-03-2025, 06:04 AM
Clubdom.com- Kate England StrapOn
https://img166.imagetwist.com/th/67115/ced23gc1z88n.jpg (https://imagetwist.com/ced23gc1z88n/JccwbR.jpg)
https://img166.imagetwist.com/th/67115/c813c2u0piiy.jpg (https://imagetwist.com/c813c2u0piiy/MuGImFyR.jpg)

Description:
Spitting saliva all over her strap-on, Kate England_s slut is bent over and ready to be rammed by her. Spreading his gaping ass hole wide she fucks him deep while smoking and ashing on his filthy ass. His yelping only grows louder as she sadistically rams into his ass. She pulls out of his stretched slut hole only to fill his mouth with his own ass juice to suck on.
Model:
Kate England
Studio:
Clubdom.com
Info:
File Name : s829kateenglandstraponslave.mp4
File Size : 582.11 MB
Resolution : 1920x1080
Duration : 00:06:44

Download K2S VIDEO:
Keep2Share Video: s829kateenglandstraponslave.mp4 (https://k2s.cc/file/e14afc325e7ff)

Clit
02-03-2025, 06:31 AM
Clubdom.com- Stretching Monkey Boys Balls
https://s10.imagetwist.com/th/67114/tph8wehz8v8l.jpg (https://imagetwist.com/tph8wehz8v8l/UJdMwwIn.jpg)
https://img202.imagetwist.com/th/67114/d0jz20woone7.jpg (https://imagetwist.com/d0jz20woone7/RXLser.jpg)

Description:
Goddess Alexis Fawx feels like playing ball games with her pathetic slave boy who she calls Monkey boy who is always playing with himself, so today she has tried 1 gallon milk jugs full of water to his balls, She summons him over making him drag the milk jugs that are tied to his slut sucks she then puts him in a spreader bar and makes him swing the jugs back and forth then begins to full force kick the juggs laughing as he squeals like a bitch, She kicks the juggs like a soccer ball laughing as monkey boys nuts get stretched even further.
Model:
Alexis Fawx
Studio:
Clubdom.com
Info:
File Name : s817alexisfawxdavafoxxmilkjuggs.mp4
File Size : 454.17 MB
Resolution : 1920x1080
Duration : 00:05:19

Download K2S VIDEO:
Keep2Share Video: s817alexisfawxdavafoxxmilkjuggs.mp4 (https://k2s.cc/file/d715a061cf639)

Clit
02-03-2025, 06:36 AM
Clubdom.com- Dava Foxx Ball Tugging Two Guys
https://img401.imagetwist.com/th/67096/pcy0uz953bon.jpg (https://imagetwist.com/pcy0uz953bon/CRMUjoKY.jpg)
https://img401.imagetwist.com/th/67096/rzbpbzmwp33q.jpg (https://imagetwist.com/rzbpbzmwp33q/XRHKqyB.jpg)

Description:
Goddess Dava Foxx knows how to have a good time, She has two of her pathetic slaves slut sacks tied off and attached to her suspension device and is going to be stretching their slut sacks today. First, she starts off by measuring both of the slaves nuts then she starts cranking on the hoist and laughing as the slaves scream and cry as she stretches their nut sacks, Then she measures again, and decides that they have a long way to go and flips the bitches over to continue with more torture and ball stretching, Now firmly gripping their slut sacks, she feels that she can do better but first starts to drive her long fingernails into their scrotums as they cry and beg for mercy, She just laughs and tells them that this is what makes her pussy wet, she then decides to just walk off and let them continue stretching for the rest of the day.
Model:
Dava Foxx
Studio:
Clubdom.com
Info:
File Name : s771davafoxxballtug.mp4
File Size : 623.42 MB
Resolution : 1920x1080
Duration : 00:07:15

Download K2S VIDEO:
Keep2Share Video: s771davafoxxballtug.mp4 (https://k2s.cc/file/1ca1e9753c660)

Clit
02-03-2025, 07:03 AM
Clubdom.com- Auction Slaves (Chemical Castration)
https://img202.imagetwist.com/th/67067/2w1nukfuvlan.jpg (https://imagetwist.com/2w1nukfuvlan/XRwJLt.jpg)
https://img34.imagetwist.com/th/67067/6h4idj602k5v.jpg (https://imagetwist.com/6h4idj602k5v/UXiIqMmU.jpg)

Description:
Mistress Cherry Morgan and Goddess Alina Long have found themselves becoming very bored lately. They have a mutual friend named Toby who picks up slaves really cheap at a local auction. Some of them are damaged, most of them are useless as most men are, but every now and then he comes up with a pretty good one. The ladies are anxiously waiting to see what he finds. Toby arrives and begins to pull out potential _. With arms duct-taped together and piece of tape over their mouths the ladies start their inspection of the merchandise. Toby thinks he is slick and tries to do a two-for-one deal. They want none of that, they want to see the goods and start pulling the bitches pants down. One is a decently hung male that could be used as a potential stud and the other is struggling with a micropenis so there is absolutely no use for him. Toby tries to sell him even cheaper and the ladies say, no thanks paying him and he_s on his way. Bitch Slave Alex was the lucky purchased one and is down on his knees in the dungeon. In tears, he pleads and begs to be let go. They explain to him that he may earn his freedom, all he has to do is make both Mistresses cum within three minutes. However, there_s a catch. Mistress Alina pulls out a gigantic syringe filled with a blue serum and explains to the slut that she will be injecting his balls with the blue liquid and if he cums before the time is up a chemical reaction will occur that will render his slut stick useless, his balls will shrivel up and fall off due to chemical castration. You better do your best and fuck us properly Bitch Alex fucks vigorously and as hard as he can. Mistress Cherry is moaning and screaming in pleasure and has an orgasm. The pathetic slave starts thinking he may have a way out. Alina says, not yet bitch it_s my turn. Pumping and thrusting with all his might, he fucks her pussy like he has never done before. Mistress Alina_s tight wet pussy has the slave squirting his load too soon. The ladies laugh and ask him if his balls are feeling warm. The chemical reaction has already begun and within a matter of days his balls will just fall off. Goddesses tell terrified Alex to lick up every last drop of his disgusting filth from Goddess_s pussy and inform him they will be contacting Toby to come back to get him as he is not worthy to stay on the estate.
Model:
Alina Long, Cherry Morgan
Studio:
Clubdom.com
Info:
File Name : s630cherryalinaauctionslave_2112makehercum.mp4
File Size : 619.79 MB
Resolution : 1920x1080
Duration : 00:07:15

Download K2S VIDEO:
Keep2Share Video: s630cherryalinaauctionslave_2112makehercum.mp4 (https://k2s.cc/file/6d67f80d510f2)

Clit
02-03-2025, 07:19 AM
Clubdom.com- Raven & Alina StrapOn Fucking Scott
https://img34.imagetwist.com/th/67087/7h0i5772mkwh.jpg (https://imagetwist.com/7h0i5772mkwh/yQRGrOW.jpg)
https://img119.imagetwist.com/th/67088/cz1zcfywnw83.jpg (https://imagetwist.com/cz1zcfywnw83/QbaHyj.jpg)

Description:
Mistress Raven Bay and Goddess Alina Long now have slave number 2 strapped down to the fuck horse and Goddess Raven Bay takes her turn pounding the bitches ass um unmercifully she loves every minute of stretching the _ man pussy she looks like she is dancing in his ass as she fucks him hard and long then makes the slut clean his own filth of her 12 inch black strap on.
Model:
Alina Long, Raven Bay
Studio:
Clubdom.com
Info:
File Name : s7562-2ravenbayalinalongstraponscott.mp4
File Size : 378.9 MB
Resolution : 1920x1080
Duration : 00:04:29

Download K2S VIDEO:
Keep2Share Video: s7562-2ravenbayalinalongstraponscott.mp4 (https://k2s.cc/file/f66c5e8d28245)

Clit
02-03-2025, 07:21 AM
Clubdom.com- Cherry & Kylie Rogue are Bratty
https://img401.imagetwist.com/th/67095/kpjypnw04shm.jpg (https://imagetwist.com/kpjypnw04shm/RyruPyz.jpg)
https://img166.imagetwist.com/th/67095/8nq9w8hqsu92.jpg (https://imagetwist.com/8nq9w8hqsu92/Qyhfjbwr.jpg)

Description:
Goddess Kylie Rogue and Cherry morgan know what an anal whore you are they are dressed in their schoolgirl outfits with sexy shiny high boots and strapped up with 12 inches of hard Bratty cock just waiting to spread your man pussy, Goddess Cherry spits on her pink cock just to give it a little lube before stretching you out. The ladies are mean and ruthless laughing at how pathetic you are with that huge butt plug shoved up your ass, stroking that little 2 inch dick as you imagine them double penetrating your ass, Finally the Bratty Doms allow you to spray your thick man goo all over your belly, only to make you scoop up every sticky drop and slurp it up fuck boy.
Model:
Cherry Morgan, Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : s762cherrymorgankylieroguebratty.mp4
File Size : 577.65 MB
Resolution : 1920x1080
Duration : 00:06:42

Download K2S VIDEO:
Keep2Share Video: s762cherrymorgankylieroguebratty.mp4 (https://k2s.cc/file/229c174c467a6)

Clit
02-03-2025, 07:37 AM
Clubdom.com- Esmi, Marsha May Chindo
https://img34.imagetwist.com/th/67057/3qxtw64brcp6.jpg (https://imagetwist.com/3qxtw64brcp6/QmbpXME.jpg)
https://img166.imagetwist.com/th/67057/u1a86c7zgx5i.jpg (https://imagetwist.com/u1a86c7zgx5i/USQyGZL.jpg)

Description:
Mistress Marsha May has her leg up on the cage riding her wet pink pussy right in her slaves face. Don_t you want to please me? He says yes goddess. She pulls him out of the cage and tells him he has three minutes to make her orgasm and puts his face right in front of her pussy. Then tells him no, not with your disgusting filthy mouth Mistress May pulls out a dildo gag and straps a prosthetic dick to his face. The slave starts fucking his mistress as hard and as fast as he can. Straining his neck with every pump. She smacks him in the head and grabs him. Harder. Faster. She exclaims. Now laying back on the couch spreading her legs open she inserts the dildo gag into her pussy again and tells him one and a half minutes left bitch. The pathetic slave tries to please his goddess but has failed. She pushes his face off and tells him I will just have to do it myself. Watch this pussy cum pathetic slave. Rubbing her clit and masturbating until pussy juice is all over the pathetic slaves face. Laughing at him she places him back in the cage. Thats okay because I can always use you as a strap on bitch.
Model:
Marsha May
Studio:
Clubdom.com
Info:
File Name : s613esmimarshamaychindo.mp4
File Size : 584.43 MB
Resolution : 1920x1080
Duration : 00:06:46

Download K2S VIDEO:
Keep2Share Video: s613esmimarshamaychindo.mp4 (https://k2s.cc/file/aca257b869498)

Clit
02-03-2025, 08:07 AM
Clubdom.com- Kendra James & Lydia Boot POV
https://img202.imagetwist.com/th/67089/ydhz3929r2n5.jpg (https://imagetwist.com/ydhz3929r2n5/GycHZBr.jpg)
https://img119.imagetwist.com/th/67089/aej3zwmllyax.jpg (https://imagetwist.com/aej3zwmllyax/CePQQAu.jpg)

Description:
Goddess Kendra James and Goddess Lydia Supremacy is looking down at you locked away in your chastity amused at how much you want their boots. As they tower over you humiliating and down grading you they decide to let you out of your chastity since its been 30 days since the last time. Goddess Kendra and Lydia begin to laugh at how hard your 2 dick got just by unlocking you, how pathetic. They begin to compare your tiny dick to their heels and let you try to please them by jerking your dick off, but wait no lube only spit and only our spit. Go ahead jerk your 2 dick with only 2 fingers since its so small and pathetic. Goddess Kendra and Goddess Lydia begin to count down since youre not allowed to release your filth till they command you to. 10,9,8,7,6,5,4,3,2,1. Now its time to lock you back up for 30 more days or maybe we will make it 60.
Model:
Kendra James, Lydia Supremacy
Studio:
Clubdom.com
Info:
File Name : s690kendralydiabootpov.mp4
File Size : 601.06 MB
Resolution : 1920x1080
Duration : 00:06:58

Download K2S VIDEO:
Keep2Share Video: s690kendralydiabootpov.mp4 (https://k2s.cc/file/a8e30302db813)

Clit
02-03-2025, 08:08 AM
Clubdom.com- Alexis Fawx StrapOn Fucking 2
https://s10.imagetwist.com/th/67113/p2f88nctex03.jpg (https://imagetwist.com/p2f88nctex03/dXkkIX.jpg)
https://img34.imagetwist.com/th/67113/dvfnd2mkapt2.jpg (https://imagetwist.com/dvfnd2mkapt2/ssXmuUU.jpg)

Description:
Goddess Alexis Fawx likes to pound man pussy, She takes at least one bitch 3 times a day just for some cardio, She just loves stretching their gaping ass holes until the slave is begging for mercy which only maj=kes her pound you fuck hole even harder, She gets off on the power and control she has over all men, Who knows? Maybe you will be next slut.
Model:
Alexis Fawx
Studio:
Clubdom.com
Info:
File Name : s793alexisfawxstraponlew.mp4
File Size : 518.29 MB
Resolution : 1920x1080
Duration : 00:05:57

Download K2S VIDEO:
Keep2Share Video: s793alexisfawxstraponlew.mp4 (https://k2s.cc/file/8c967c47ffde0)

Clit
02-03-2025, 08:10 AM
Clubdom.com- Jamie & Kimber- Human Canvas Destroyed By His Goddesses
https://img401.imagetwist.com/th/67085/868kl2j2d0at.jpg (https://imagetwist.com/868kl2j2d0at/PMfsSO.jpg)
https://img166.imagetwist.com/th/67085/ijriqs0qlnc9.jpg (https://imagetwist.com/ijriqs0qlnc9/JzEmpyI.jpg)

Description:
Goddess Jamie Valentine and Goddess Kimder Woods have one of their slaves bent over and locked into their canning devise. Making this worthless slave beg to be canned they begin taking turns turning this empty canvas into art. Cane after cane after cane this slave begs for mercy but all that does is make his Goddesses cane even harder. Then Goddess Jamie and Kimber make this pathetic slave count each stroke they take as tears run down his face. Goddess Kimber then informs this human canvas that his day is not over and that after they have finished making his back as reed as an apple they will then destroy his man pussy with their 12 strap-ons.
Model:
Jamie Valentine, Kimber Woods
Studio:
Clubdom.com
Info:
File Name : s727jamievalentinekimberwoodscaning.mp4
File Size : 705.8 MB
Resolution : 1920x1080
Duration : 00:08:01

Download K2S VIDEO:
Keep2Share Video: s727jamievalentinekimberwoodscaning.mp4 (https://k2s.cc/file/c99be33c82337)

Clit
02-03-2025, 08:35 AM
Clubdom.com- Esmi & Marsha May Strapon Fucking
https://img166.imagetwist.com/th/67057/cfkdlyb43tc1.jpg (https://imagetwist.com/cfkdlyb43tc1/UPpKHue.jpg)
https://img401.imagetwist.com/th/67057/m6m41ne5xemy.jpg (https://imagetwist.com/m6m41ne5xemy/hEdDzB.jpg)

Description:
Goddess Esmi Lee and Mistress May can not decide whether they want to fuck or cane this bitch. So they fill his mouth full of cock while caning him. That_s okay. I_ll warm the bitch up., Goddess Esmi taunts, then he_ll be begging for cock Sadistic and brutal Goddess Esmi canes his ass severely until wearing the bitch_s ass out. She wastes no time in bending him over so that Mistress May can straddle the bitch like a pony. They Fuck him hard and wear his pathetic ass out once again, before Mistress May demands he flip over. I want a shot at that mam Pussy She says. She pile drives him and tells him to take all of her 12 inch black cock til he is squealing like a little pig. Your day has just begun... The ladies laugh.
Model:
Esmi Lee, Marsha May
Studio:
Clubdom.com
Info:
File Name : s616esmimarshamaystraponlew.mp4
File Size : 549.9 MB
Resolution : 1920x1080
Duration : 00:06:22

Download K2S VIDEO:
Keep2Share Video: s616esmimarshamaystraponlew.mp4 (https://k2s.cc/file/0df648406bfd7)

Clit
02-03-2025, 08:35 AM
Clubdom.com- Hope Harper & Marsha May Milking
https://img166.imagetwist.com/th/67091/4470scoaj7ay.jpg (https://imagetwist.com/4470scoaj7ay/QkjgqLd.jpg)
https://img69.imagetwist.com/th/67091/yyaxxojsrgal.jpg (https://imagetwist.com/yyaxxojsrgal/XHiWuqwr.jpg)

Description:
Its that time of the month for one of their lucky slaves to get milked like a cow. Goddess Marsha May and Goddess Hope Harper walk up to their whimpering slave chained to their table. They begin to milk this pathetic slaves filth stick and within seconds he is already releasing some of his filth, but quickly stopped by his Goddesses since he was not given permission. Stroke after stroke Goddess Hope and Goddess Marsha vigorously milk this worthless slave. Once they have given him permission to release his filth their slave begins to shake and within no time he spreads his filth like a geezer getting it on his Goddesses which is was a big mistake. Soon Goddess Marsha and Goddess Hope are punching him in his filth sacs and pathetic stick making him cry in pain. After they have taken a few swings they then scoop up his mess and shove it in his mouth causing him to gag.
Model:
Hope Harper, Marsha May
Studio:
Clubdom.com
Info:
File Name : s717hopeharpermarshamaymilking.mp4
File Size : 684.6 MB
Resolution : 1920x1080
Duration : 00:07:57

Download K2S VIDEO:
Keep2Share Video: s717hopeharpermarshamaymilking.mp4 (https://k2s.cc/file/6684d5cbbb990)

Clit
02-03-2025, 09:08 AM
Clubdom.com- Veronica Cohen & Kylie Rogue Caning
https://img202.imagetwist.com/th/67116/frzw21bhqmg6.jpg (https://imagetwist.com/frzw21bhqmg6/SqQAdc.jpg)
https://img119.imagetwist.com/th/67116/ew4tbi7uh908.jpg (https://imagetwist.com/ew4tbi7uh908/XAXijQ.jpg)

Description:
Mistress Veronica Cohen and Kylie Rogue play a game of rock paper scissors to see who will mark their slave first Veronica wins and wastes no time ordering her slave to stick out his ass to be caned. The Mistresses amuse each other by taking turns savagely caning the bitch. But now that the they are excited from vigorously punishing their slaves ass. Deciding to keep the lusty brutality, they tell the slave they are only leaving to grab their strap-ons
Model:
Kylie Rogue, Veronica Cohen
Studio:
Clubdom.com
Info:
File Name : s832veronicacohenkylieroguecaning.mp4
File Size : 765.71 MB
Resolution : 1920x1080
Duration : 00:08:51

Download K2S VIDEO:
Keep2Share Video: s832veronicacohenkylieroguecaning.mp4 (https://k2s.cc/file/ceed5a1c84c2f)

Clit
02-03-2025, 09:27 AM
Clubdom.com- Michelle Lacey Rules Over Your
https://s10.imagetwist.com/th/67119/c3hjwur852qg.jpg (https://imagetwist.com/c3hjwur852qg/Pwyfmq.jpg)
https://img119.imagetwist.com/th/67119/i9mpvit2hs0h.jpg (https://imagetwist.com/i9mpvit2hs0h/GQhWYc.jpg)

Description:
You can_t make it grow any bigger than that? Very well, Mistress Michelle will begin your instruction then. Take that dicklet into your hands, you two finger wanker Begin pumping that clit and Mistress Michelle will walk you through all the things she would do to you if she were there watching that disgusting display. Imagining pressing the bottom of her shoe on your worthless cocklet is bringing a smile to her lips, but she knows like a brainless filth filled slave, you are staring at her breasts and touching yourself. Too obsessed with spilling your own filth to do anything but follow her orders, so Listen closely to Michelle Lacey as she counts you down
Model:
Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s849kylieroguemichellelacypov.mp4
File Size : 490.29 MB
Resolution : 1920x1080
Duration : 00:05:40

Download K2S VIDEO:
Keep2Share Video: s849kylieroguemichellelacypov.mp4 (https://k2s.cc/file/9989820446856)

Clit
02-03-2025, 09:39 AM
Clubdom.com- Boot Licking Chindo Sluts
https://img401.imagetwist.com/th/67056/1z308atunts5.jpg (https://imagetwist.com/1z308atunts5/kTIgnP.jpg)
https://img119.imagetwist.com/th/67056/2x2stlgzbuf0.jpg (https://imagetwist.com/2x2stlgzbuf0/aBRpucH.jpg)

Description:
Goddess Jamie Valentine and Mistress Kylie Rogue are having their black shinny boots licked and worshiped by their pathetic slaves. The ladies are feeling frisky and start kissing and fondling one another. Then decide to tease these pathetic _. Jamie says you boys are so good at licking our boots, maybe you want a chance to lick something else? Mistress Kylie and Jamie spread their legs open and pull their slaves faces within an inch of their pussies. Making them breathe in their goddess_s essence. They then tell the slaves that there is only one way they can please them. Goddess Jamie pulls out a black chindo and straps them to their slaves face. Instructing them to fuck them until they reach an orgasm. All the while laughing at how pathetic these boots bitches really are..
Model:
Jamie Valentine, Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : s607kylieroguejamievalentinechindo.mp4
File Size : 682.16 MB
Resolution : 1920x1080
Duration : 00:07:54

Download K2S VIDEO:
Keep2Share Video: s607kylieroguejamievalentinechindo.mp4 (https://k2s.cc/file/898c0343cc88a)

Clit
02-03-2025, 09:43 AM
Clubdom.com- Kylie Rogue & Michelle Lacy Caning
https://img401.imagetwist.com/th/67118/hugf671fnu8v.jpg (https://imagetwist.com/hugf671fnu8v/ZLfwdhAz.jpg)
https://img202.imagetwist.com/th/67118/vq8v9coa9o5s.jpg (https://imagetwist.com/vq8v9coa9o5s/fuGhRiEy.jpg)

Description:
Kylie Rogue and Michelle Lacy swing their canes onto this slave_s pale ass. He twists in agony between each marking, But Kylie only enjoys the bitches screeches that much more as Michelle displays the most ruthless of her handiwork
Model:
Kylie Rogue, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s847kylieroguemichellelacycanning.mp4
File Size : 681.8 MB
Resolution : 1920x1080
Duration : 00:07:47

Download K2S VIDEO:
Keep2Share Video: s847kylieroguemichellelacycanning.mp4 (https://k2s.cc/file/521fd4dd0d474)

Clit
02-03-2025, 09:53 AM
Clubdom.com- Stretching His Fuck Hole
https://img401.imagetwist.com/th/67054/9qm0849gyt5b.jpg (https://imagetwist.com/9qm0849gyt5b/TQvPhJA.jpg)
https://img202.imagetwist.com/th/67054/qo2jm5tcdjvv.jpg (https://imagetwist.com/qo2jm5tcdjvv/ATveaW.jpg)

Description:
Mistress Molly Jane and Goddess Marina Angel stretch the slaves ass wide open as they pound him with their huge 10 inch black cocks. A slut is led in on a leash and made to choke and gag on every inch of Mistress Molly_s huge strap on. Then the slut is bent over the couch and fucked hard then flipped over and double fucked by both women. They make him beg for every inch, pleading for mercy as the ladies laugh and continue to pound his fuck hole.
Model:
Marina Angel, Molly Jane
Studio:
Clubdom.com
Info:
File Name : s592marinaangelstrapon1.mp4
File Size : 557.66 MB
Resolution : 1920x1080
Duration : 00:06:28

Download K2S VIDEO:
Keep2Share Video: s592marinaangelstrapon1.mp4 (https://k2s.cc/file/e9c41f1e3e3a0)

Clit
02-03-2025, 09:55 AM
Clubdom.com- Shredding Another Slaves Ass (Caning)
https://img166.imagetwist.com/th/67055/7u4bim5h5ngt.jpg (https://imagetwist.com/7u4bim5h5ngt/lLXSSd.jpg)
https://s10.imagetwist.com/th/67055/mnm1aofwfq72.jpg (https://imagetwist.com/mnm1aofwfq72/vAamQXa.jpg)

Description:
Goddess Esmi Lee, Mistress Molly Jane and Goddess Dava Foxx are ready to break in some new canes on this bitches ass. A brutal caning ensues as the sadistic women show no mercy for this _ ripe ass as they beat it raw, red, welted and swollen. They make him count off every stroke. Then Goddess Esmi Lee tells the slave count them off in Spanish. The slave is yelling uno, dos, tres as Goddess canes him even harder and faster telling him I don_t even speak Spanish you pathetic bitch. The ladies laugh after examining what fine work they have done and decide now it_s time to fuck this bitch. Let_s go and get our strap ons
Model:
Dava Foxx, Esmi Lee, Molly Jane
Studio:
Clubdom.com
Info:
File Name : s598davafoxxesmileemollyjanecaning.mp4
File Size : 696.98 MB
Resolution : 1920x1080
Duration : 00:08:02

Download K2S VIDEO:
Keep2Share Video: s598davafoxxesmileemollyjanecaning.mp4 (https://k2s.cc/file/6070cf68b43ee)

Clit
02-03-2025, 10:06 AM
Clubdom.com- Fuck My Boy Pussy Brat Dom
https://img119.imagetwist.com/th/67097/1v2yrd6x2x8c.jpg (https://imagetwist.com/1v2yrd6x2x8c/OXsRQhu.jpg)
https://img401.imagetwist.com/th/67097/42g2tmar05jn.jpg (https://imagetwist.com/42g2tmar05jn/qJapuh.jpg)

Description:
Bratty Dom Anna Lee has had to satisfy herself And now is strapped up with a thick 10 inch cock and ready to spread and gape some boy pussy. Bratty Dom Anna makes her slut puppy suck and deep throat her hard cock, Gagging and spitting all over it as she makes him beg her to Fuck his boy pussy< She smacks his face and bends him over the fuck horse and spreads that tight little boy cunt and rams and fucks him hard until he begs for mercy.
Model:
Anna Lee
Studio:
Clubdom.com
Info:
File Name : s7693-3annaleebratstrapon.mp4
File Size : 507.4 MB
Resolution : 1920x1080
Duration : 00:05:53

Download K2S VIDEO:
Keep2Share Video: s7693-3annaleebratstrapon.mp4 (https://k2s.cc/file/8d5f9f7fc3698)

Clit
02-03-2025, 10:15 AM
Clubdom.com- Veronica & Kylie Rogue- Spilling Your FIlth, Ashtray Bitch
https://img34.imagetwist.com/th/67118/ebmfullsaami.jpg (https://imagetwist.com/ebmfullsaami/HQpYqaBV.jpg)
https://img34.imagetwist.com/th/67118/ctsx5v64wpe1.jpg (https://imagetwist.com/ctsx5v64wpe1/tWVepU.jpg)

Description:
Mistress Veronica Cohen and Kylie Rogue share a smoke while deciding what to do with you. While they smoke you should already have your asshole covered in spit and your dicklet being stroked. Blowing smoke into your face, the Mistresses want to see you fuck a caning stick and open your mouth to be their ashtray as well. Don_t stop stroking bitch boyThey ash in your mouth since coughing and gagging excites them, But Veronica wants to see you swallow their ashes too. Don_t bore your mistresses, you_re lucky to even watch them Slap those balls and keep that mouth open for your Mistresses spit and ashes before continuing to stroke. Now that they_re done with you, They need somewhere to put out their cigarettes. Putting it out on your tongue bores Kylie Though...so present those filth sacks to her
Model:
Kylie Rogue, Veronica Snow
Studio:
Clubdom.com
Info:
File Name : s836veronicacohenkylierogueashtraypov.mp4
File Size : 563.62 MB
Resolution : 1920x1080
Duration : 00:06:36

Download K2S VIDEO:
Keep2Share Video: s836veronicacohenkylierogueashtraypov.mp4 (https://k2s.cc/file/7141b3bd9adc8)

Clit
02-03-2025, 10:20 AM
Clubdom.com- Alexis & Dava Need Roadside Assistance P1
https://img202.imagetwist.com/th/67114/0bm6ebmp31mm.jpg (https://imagetwist.com/0bm6ebmp31mm/JlszATG.jpg)
https://s10.imagetwist.com/th/67114/c4g7yzhiro9n.jpg (https://imagetwist.com/c4g7yzhiro9n/pDLvgUQ.jpg)

Description:
Goddess Alexis Fawx and Dava Foxx use the old broken down car trick to catch a fuck boy, They pull off to the side of the road and flag down some dude in a truck, He thinks he is gods gift to woman as he takes his shirt off and takes a look at their car, And tells them he can give them a ride that their motor is shot, Goddess Dava pricks him with her love needle and he faints, the ladies drag him and throw him in the back of his truck and take him back to ClubDom and have him restrained in a fiddle holding his neck and hands, They then produce a syringe with a blue fluid and inject his balls as he screams then tell him if he cums twice within the hour a chemical reaction will take place turning his balls into little shriveled up raisins rendering them useless. Then the sexy Doms start to tease him playing with each others full breasts and kissing knowing he is getting hard, Then they proceed to milk the filth right from his slut sacks feeding him every last drop, Alexis states well there is the first load lol.
Model:
Alexis Fawx, Dava Foxx
Studio:
Clubdom.com
Info:
File Name : s8131-2alexisfawxdavafoxxmilking.mp4
File Size : 714.42 MB
Resolution : 1920x1080
Duration : 00:08:20

Download K2S VIDEO:
Keep2Share Video: s8131-2alexisfawxdavafoxxmilking.mp4 (https://k2s.cc/file/dd58ab2408062)

Clit
02-03-2025, 10:24 AM
Clubdom.com- Michelle Lacy & Lydia Supremacy
https://img119.imagetwist.com/th/67100/hgdibsqwkz68.jpg (https://imagetwist.com/hgdibsqwkz68/OXmmEn.jpg)
https://img34.imagetwist.com/th/67100/wb6uvenrdi5r.jpg (https://imagetwist.com/wb6uvenrdi5r/WHonuA.jpg)

Description:
Goddess Lydia Supremacy and Mistress Michelle Lacy have their slave on his knees where he belongs making this pathetic bitch stroke his tiny pathetic man clit, His penis is so small they have renamed it Dicklet. The women are mean and cruel making him use his thumb and index finger to stroke his little slut stick Laughing and counting him down from 10 then letting hi, dribble his tiny drops of man filth all over the floor and then making him lick it up.
Model:
Lydia Supremacy, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s699michellelacylydiasupremicypov.mp4
File Size : 658.3 MB
Resolution : 1920x1080
Duration : 00:07:38

Download K2S VIDEO:
Keep2Share Video: s699michellelacylydiasupremicypov.mp4 (https://k2s.cc/file/637ffe974ff9b)

Clit
02-03-2025, 10:56 AM
Clubdom.com- Charlie Hart StrapOn Fucking
https://img34.imagetwist.com/th/67103/u0r0qrieemxy.jpg (https://imagetwist.com/u0r0qrieemxy/tIOJOQR.jpg)
https://img401.imagetwist.com/th/67103/6n5ckmbqd7c5.jpg (https://imagetwist.com/6n5ckmbqd7c5/HwiMjTjF.jpg)

Description:
ClubDom, In Our World Women Rule. Mistress Cheyenne has got her slave by the balls and isn_t going to let him off easy It_s ball busting time In Our World ..
Model:
Charley Hart
Studio:
Clubdom.com
Info:
File Name : s7972-2strapon.mp4
File Size : 303.43 MB
Resolution : 1920x1080
Duration : 00:03:31

Download K2S VIDEO:
Keep2Share Video: s7972-2strapon.mp4 (https://k2s.cc/file/9ac0dd2528ec1)

Clit
02-03-2025, 11:02 AM
Clubdom.com- Raven & Alina StrapOn Fucking
https://img401.imagetwist.com/th/67087/gfp3az2usb8j.jpg (https://imagetwist.com/gfp3az2usb8j/msGkVJ.jpg)
https://img119.imagetwist.com/th/67087/27rbsnrwxkeg.jpg (https://imagetwist.com/27rbsnrwxkeg/lZHeKS.jpg)

Description:
Mistress Raven Bay and Goddess Alina Long walk up to two of their slaves Jammed in the same cage. As they tower over their slaves deciding which one they are going to shove their 12 strap-on into. After thinking for a sec, Goddess Alina finally picks one. she drags this pathetic bitch over on his knees and she shove her strap-on down his throat making him gag. Goddess Alina then bends this fuck toy over and rams his man pussy while Mistress Raven strokes her strap-on smoking a cigarette informing the other slave to watch since he is next. Goddess Alina pounds this slaves man pussy till he is yelling in pain.
Model:
Alina Long, Raven Bay
Studio:
Clubdom.com
Info:
File Name : s7561-2ravenbayalinalongstrapon.mp4
File Size : 427.66 MB
Resolution : 1920x1080
Duration : 00:04:56

Download K2S VIDEO:
Keep2Share Video: s7561-2ravenbayalinalongstrapon.mp4 (https://k2s.cc/file/2b1c83aa88093)

Clit
02-03-2025, 11:36 AM
Clubdom.com- Callie Nicole & Charley Hart- Caning Mercy
https://s10.imagetwist.com/th/67113/po1bo791lxiv.jpg (https://imagetwist.com/po1bo791lxiv/QynpTWt.jpg)
https://img166.imagetwist.com/th/67113/8jqr5acx0ent.jpg (https://imagetwist.com/8jqr5acx0ent/wfIOxEKV.jpg)

Description:
Mistress Charley Hart and Goddess Callie Nichole are having some fun with slave 337 they are creating crimson red artwork on the _ ass, they enjoy starting out with a blank canvass and striping it up in all sorts of shades of red, As the bitch is screaming Mercy, Mistress Charley tells him you want mercy? That is my canes name slut, so keep begging for Mercy and I will continue to give you Mercy, The women are cruel and sadistic They love making their bitch suffer.
Model:
Callie Nicole, Charley Hart
Studio:
Clubdom.com
Info:
File Name : s7962-2mynameismercycaning.mp4
File Size : 595.47 MB
Resolution : 1920x1080
Duration : 00:06:55

Download K2S VIDEO:
Keep2Share Video: s7962-2mynameismercycaning.mp4 (https://k2s.cc/file/afbb27640a333)

Clit
02-03-2025, 11:44 AM
Clubdom.com- Cherry & Kylie Jerking Your Slut Stick
https://img166.imagetwist.com/th/67112/noc31gc0m4io.jpg (https://imagetwist.com/noc31gc0m4io/wtMfkDql.jpg)
https://img401.imagetwist.com/th/67112/pdg5mhyzmnbh.jpg (https://imagetwist.com/pdg5mhyzmnbh/iOaPkrQB.jpg)

Description:
Goddess Kylie Rogue and Goddess Cherry morgan instruct your slutty ass on how to jerk off, With a huge black dildo shoved up your fuck hole, They know it_s what you dream about and what gets you off so go get that big black cock that they told you to buy, Spit on it and plunge it into your asshole, Then take your thumb and forefinger and start jerking that pathetic excuse you call a cock, And their countdown begins you have about 4 minutes to spray that disgusting load of yours.
Model:
Cherry Morgan, Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : s767cherrymorgankylieroguepov.mp4
File Size : 350.79 MB
Resolution : 1920x1080
Duration : 00:04:05

Download K2S VIDEO:
Keep2Share Video: s767cherrymorgankylieroguepov.mp4 (https://k2s.cc/file/97927b165081b)

Clit
02-03-2025, 12:10 PM
Clubdom.com- Stretching Your Man Cunt
https://img166.imagetwist.com/th/67078/qibvxk3mhnl2.jpg (https://imagetwist.com/qibvxk3mhnl2/VMmlWAS.jpg)
https://img119.imagetwist.com/th/67079/qitfp72f30i1.jpg (https://imagetwist.com/qitfp72f30i1/uGrCgA.jpg)

Description:
Goddess Kylie Rouge and Mistress Nikki Ortega have their three slaves caged around their beautiful pool on the clubdom estate and they_re trying to decide which bitch they want to fuck who_s man cunt will they stretch out today Kylie asks Bitch number one if he wants to get an ass pounding of course the slut replies yes goddess the ladies walk over and retrieve the bitch from his cage then instruct him to lube up their big 12 inch strapon cocks he sucks it like a pussy So Kylie pulls the bitch back takes her cigarette and Burns it into his chest as he screams and the ladies laugh then she just bends the bitch over and starts to ass pound him shoving her huge black 12 inch cock up his anus as Mistress Nikki chokes his slutty mouth.
Model:
Kylie Rogue, Nikki Ortega
Studio:
Clubdom.com
Info:
File Name : s657kylieroguenikkiortagastrapon.mp4
File Size : 609.92 MB
Resolution : 1920x1080
Duration : 00:07:05

Download K2S VIDEO:
Keep2Share Video: s657kylieroguenikkiortagastrapon.mp4 (https://k2s.cc/file/da92ca59abb4f)

Clit
02-03-2025, 12:21 PM
Clubdom.com- Anna Lee Brat Chindo
https://img34.imagetwist.com/th/67093/tns5xc0dsf3c.jpg (https://imagetwist.com/tns5xc0dsf3c/uqlNBWP.jpg)
https://img119.imagetwist.com/th/67094/b8zv8lgadxm1.jpg (https://imagetwist.com/b8zv8lgadxm1/LdpyJMSO.jpg)

Description:
Goddess Anna Lee is enjoying her cigarette while she sits above her slaves courters. While this worthless slave tries to look up at her through his cage bars, Goddess Anna makes him beg her to fuck his boy pussy while she blows smoke in his face. She then informs this pathetic bitch that he must first please his Goddess and lets him out. Once her slave is unlocked and on his knees she straps a chindo to his fuck hole and instructs him that he better please her or else.
Model:
Anna Lee
Studio:
Clubdom.com
Info:
File Name : s7691-3annaleebratchindo.mp4
File Size : 602.68 MB
Resolution : 1920x1080
Duration : 00:06:58

Download K2S VIDEO:
Keep2Share Video: s7691-3annaleebratchindo.mp4 (https://k2s.cc/file/e5a4ab8a879fe)

Clit
02-03-2025, 12:24 PM
Clubdom.com- Dava Foxx Caning Tiedup Douchebag
https://img119.imagetwist.com/th/67126/solsh4qwncms.jpg (https://imagetwist.com/solsh4qwncms/iUYxMum.jpg)
https://img69.imagetwist.com/th/67126/v3ii66rzahx3.jpg (https://imagetwist.com/v3ii66rzahx3/dpQWPHv.jpg)

Description:
Goddess Dava Foxx has her absolute favorite little bitch bent over the cage. This ass is too white for me she says, and explains that she now needs to cane it up for her amusement. She smiles and forces the slave to count each cane stroke. She goes faster and faster, trying to get him to mess up his count. When he figets out of place from the immense pain, she digs the cane into his back and pushes him back down into place. She is ruthless.
Model:
Dava Foxx
Studio:
Clubdom.com
Info:
File Name : s859davafoxxcaning.mp4
File Size : 626.98 MB
Resolution : 1920x1080
Duration : 00:07:17

Download K2S VIDEO:
Keep2Share Video: s859davafoxxcaning.mp4 (https://k2s.cc/file/e1fc6fcfa5988)

Clit
02-03-2025, 12:42 PM
Clubdom.com- Jamie Valentine Milking Slut 227
https://img401.imagetwist.com/th/67079/ouaelz6jbuoh.jpg (https://imagetwist.com/ouaelz6jbuoh/oaHjvktF.jpg)
https://img69.imagetwist.com/th/67080/s9fz4l7pnm0h.jpg (https://imagetwist.com/s9fz4l7pnm0h/JJXKeAl.jpg)

Description:
Time to milk another slut on the ClubDom estate and this pathetic slut is chained up to a tree as Mistress Jamie Valentine and Goddess Kylie Rogue Terrorize this bitch threatening to cane his filthy slut sacks right off Then they start stroking his slut stick hard and fast knowing they will pull his milk right out him they stroke hard as their fist slams into his balls the bitch can_t hold out and shoots his load into Kylie_s black gloved hand and them proceeds to wipe every last drop into the _ mouth.
Model:
Jamie Valentine
Studio:
Clubdom.com
Info:
File Name : cd_s662_jamie_valentine_milking.mp4
File Size : 589.11 MB
Resolution : 1920x1080
Duration : 00:06:48

Download K2S VIDEO:
Keep2Share Video: cd_s662_jamie_valentine_milking.mp4 (https://k2s.cc/file/4aee1795435df)

Clit
02-03-2025, 12:54 PM
Clubdom.com- Jamie Valentine & Kimber StrapOn Fucking
https://img119.imagetwist.com/th/67097/yiiq9ap90yvg.jpg (https://imagetwist.com/yiiq9ap90yvg/pPTSlU.jpg)
https://img119.imagetwist.com/th/67098/7bkxmnbvsgbv.jpg (https://imagetwist.com/7bkxmnbvsgbv/efZQlWFO.jpg)

Description:
ClubDom, In Our World Women Rule. Mistress Cheyenne has got her slave by the balls and isn_t going to let him off easy It_s ball busting time In Our World ..
Model:
Jamie Valentine, Kimber Woods
Studio:
Clubdom.com
Info:
File Name : s732jamievalentinekimberwoodsstrapon.mp4
File Size : 617.1 MB
Resolution : 1920x1080
Duration : 00:07:08

Download K2S VIDEO:
Keep2Share Video: s732jamievalentinekimberwoodsstrapon.mp4 (https://k2s.cc/file/55b7908d132b5)

Clit
02-03-2025, 12:54 PM
Clubdom.com- Hope Harper & Marsha May Caning
https://img69.imagetwist.com/th/67089/iyvg3o9mihns.jpg (https://imagetwist.com/iyvg3o9mihns/OYgnIv.jpg)
https://s10.imagetwist.com/th/67089/hwca93lycfzn.jpg (https://imagetwist.com/hwca93lycfzn/EhsFGYFQ.jpg)

Description:
Goddess Marsha May and Hope Harper like beating their bitch. Goddess Hope walks her dog out on a leash and presents him to Goddess Marsha. They bend their bitch over the stock and unleash a brutal sadistic caning. Goddess Marsha even straddles her bitch as she canes his ass even harder making him beg for every stroke. After they are through they feel it_s time to play a little game of fetch. They throw their canes out into the yard allowing the bitch slave to run out and retrieve them.
Model:
Hope Harper, Marsha May
Studio:
Clubdom.com
Info:
File Name : s716hopeharpermarshamaycaining.mp4
File Size : 732.05 MB
Resolution : 1920x1080
Duration : 00:08:16

Download K2S VIDEO:
Keep2Share Video: s716hopeharpermarshamaycaining.mp4 (https://k2s.cc/file/adb5f287cc11b)

Clit
02-03-2025, 01:18 PM
Clubdom.com- Anally Stretching And Tormenting Their Slaves
https://img401.imagetwist.com/th/67080/ek6uolfednan.jpg (https://imagetwist.com/ek6uolfednan/tPfYTYb.jpg)
https://img119.imagetwist.com/th/67080/9dco4elkyyi9.jpg (https://imagetwist.com/9dco4elkyyi9/mawqSYB.jpg)

Description:
Mistress Kylie Rogue is teaching another slave a lesson at ClubDom by fucking him in his man pussy with her strap-on hard and rough. While Mistress Kylie is anally ripping her pathetic slave and making him count every thrust she takes, Goddess Venus Divine drags her worthless slave out of the dungeon and into his cage. As Mistress Kylie pounds her now screaming slave, Goddess Venus begins to cattle prod her bitch everywhere on his body making him yell and squirm in his cage. While Mistress is destroying her slaves ass he looks up and sees Goddess Venus standing over him with her cattle prod in her hand. As this pathetic slave has a strap-on rammed deep inside him, he is tormented with the cattle prod inches from his face. After they have had their fun fucking and tormenting this slave, Goddess Venus informs her worthless bitch that he is next, but he will be receiving a lot larger strap-on. When both Goddess Venus and Mistress Kylie see the terror that comes across this slaves face, they begin to laugh in amusement while the other slave cleans Mistress Kylies strap-on with his tongue.
Model:
Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : s7011-2_venuskyliestrapon.mp4
File Size : 650.67 MB
Resolution : 1920x1080
Duration : 00:07:32

Download K2S VIDEO:
Keep2Share Video: s7011-2_venuskyliestrapon.mp4 (https://k2s.cc/file/39d571c7b7d11)

Clit
02-03-2025, 01:22 PM
Clubdom.com- Michelle Lacy & Brianna Strapon
https://img202.imagetwist.com/th/67054/es4qoph7uvhv.jpg (https://imagetwist.com/es4qoph7uvhv/vXSNMF.jpg)
https://img119.imagetwist.com/th/67054/v1u7iibi5suk.jpg (https://imagetwist.com/v1u7iibi5suk/YBnvCUPR.jpg)

Description:
Goddess Brianna and Mistress Michelle Lacy decide it_s time to fuck another man pussy. They both walk into the dungeon brandishing huge thick strap on cocks and tell the slave that it_s time to stretch his little pussy hole wide open. They have their cocks lubed up by his little pouty fuck hole and then flip the bitch over and pile drive him with every inch of their strap on into his gaping asshole. He screams begging for mercy while he is placed in a head stalk with his arms restrained. Both take turns fucking his man pussy over and over.
Model:
Goddess Brianna, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s588michellelacybriannastrapon.mp4
File Size : 440.55 MB
Resolution : 1920x1080
Duration : 00:05:05

Download K2S VIDEO:
Keep2Share Video: s588michellelacybriannastrapon.mp4 (https://k2s.cc/file/bf790ed5e3a58)

Clit
02-03-2025, 01:28 PM
Clubdom.com- Whipping Your Ass
https://img166.imagetwist.com/th/67054/ertzi26x7qvw.jpg (https://imagetwist.com/ertzi26x7qvw/ziklAWIy.jpg)
https://s10.imagetwist.com/th/67054/jeq6p22ddbs9.jpg (https://imagetwist.com/jeq6p22ddbs9/dqNYzKu.jpg)

Description:
Mistress Michelle Lacy pulls her sleeping bitch from his cage and asks him what his sole purpose in life is. The slave answers to please you Goddess. Of course she says that_s right bitch and I feel like whipping some ass. She then restrains the bitches wrist to a spreader bar and wails away whipping his back and ass until it is completely red and raw. Making him beg for more. The slave is grateful and thanks Mistress Michelle. She snickers and says oh I have much more planned for your night my sweet whipping bitch.
Model:
Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s589michellelacybriannawhipping.mp4
File Size : 524.92 MB
Resolution : 1920x1080
Duration : 00:06:04

Download K2S VIDEO:
Keep2Share Video: s589michellelacybriannawhipping.mp4 (https://k2s.cc/file/f45d503fe6c8b)

Clit
02-03-2025, 01:33 PM
Clubdom.com- Cherry & Alina Pony Cart Boot Worship
https://img34.imagetwist.com/th/67064/ewx3mtdxkjay.jpg (https://imagetwist.com/ewx3mtdxkjay/BcoWkwR.jpg)
https://s10.imagetwist.com/th/67064/dw08tn1to13j.jpg (https://imagetwist.com/dw08tn1to13j/QleelU.jpg)

Description:
When you have acres and acres of land like the sprawling Club Dom estate, it makes sense that a Goddess would need a fitting method of transportation. Naturally Mistresses Cherry Morgan and Alina Long have two willing pony boys eagerly waiting to take them all around the property. After a tour and race, the Goddesses grow bored and decide some boot worship is in order The extremely lucky slaves are overjoyed to be allowed the privilege of running their tongues all over the glistening boots of their Goddess. Mistress Cherry and Alina encourage their boot _ to continue paying tribute to them by cleaning every inch of their magnificent boots, including licking the filthy soles Both Mistresses stand over their boot bitches as they look up at the amazing bodies of both Goddesses with awe. Unsatisfied, the Domes demand the man whores suck and swallow the entire heel of their boots, making love and orally pleasing every spiked inch. They allow no mercy on their bitches, driving their heels down their whole throats. Finally satiated, Goddesses Cherry and Alina decide the boot _ have done an adequate job and demand they carry their pony carts back to the mansion.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : s629cherryalinaponycartbootworship.mp4
File Size : 576.92 MB
Resolution : 1920x1080
Duration : 00:06:40

Download K2S VIDEO:
Keep2Share Video: s629cherryalinaponycartbootworship.mp4 (https://k2s.cc/file/66329b97df83c)

Clit
02-03-2025, 02:14 PM
Clubdom.com- Alexis Fawx Manhole Stretching
https://img119.imagetwist.com/th/67115/qs3qq5lqwhui.jpg (https://imagetwist.com/qs3qq5lqwhui/IbbPoL.jpg)
https://img202.imagetwist.com/th/67115/3sg4lioxegd6.jpg (https://imagetwist.com/3sg4lioxegd6/pjEDYzGB.jpg)

Description:
Goddess Alexis Fawx feels like enjoying some time out by the pool so she invites her slutty slave and rams her huge 12 inch cock in his mouth making him thank her for getting to spend some time by the pool with her today, She then Rams her hard cock up his ass balls deep sometimes fucking him hard and fast and then slow deep strokes, She knows what an ass slut he is and makes him squeal like a pig ass she spends the afternoon pounding his ass.
Model:
Alexis Fawx
Studio:
Clubdom.com
Info:
File Name : s822alexisfawxdavafoxxstraponlew.mp4
File Size : 558.54 MB
Resolution : 1920x1080
Duration : 00:06:28

Download K2S VIDEO:
Keep2Share Video: s822alexisfawxdavafoxxstraponlew.mp4 (https://k2s.cc/file/c808d4a48f3e4)

Clit
02-03-2025, 02:41 PM
Clubdom.com- Milking Your Slutty Balls (Edging)
https://img34.imagetwist.com/th/67056/xc492q3f9ac8.jpg (https://imagetwist.com/xc492q3f9ac8/BepoLhe.jpg)
https://img401.imagetwist.com/th/67056/jdh86szih8b1.jpg (https://imagetwist.com/jdh86szih8b1/AHQDmuNs.jpg)

Description:
Goddess Jamie Valentine and Mistress Kylie Rogue decide it_s time to drain another bitches _ sacks of every bit of man filth. The bitch is milked hard and fast. The ladies are demanding that he produces a huge load because it will be the only nourishment the slut gets for weeks. They edge him right to the brink and then laugh as he sprays squirt after squirt his thick white milky man goo all over Goddess Jamie_s black glove. He is then feed every last drop. See you again in thirty days bitch
Model:
Jamie Valentine, Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : s608kylieroguejamievalentinemilking.mp4
File Size : 690.86 MB
Resolution : 1920x1080
Duration : 00:08:00

Download K2S VIDEO:
Keep2Share Video: s608kylieroguejamievalentinemilking.mp4 (https://k2s.cc/file/4f3ce32e44c30)

Clit
02-03-2025, 02:56 PM
Clubdom.com- Kylie Rogue and Dava Foxx Pussy Worship
https://img69.imagetwist.com/th/67092/01sflp7z91kl.jpg (https://imagetwist.com/01sflp7z91kl/yeWnNPh.jpg)
https://img202.imagetwist.com/th/67092/l8cwrkm92920.jpg (https://imagetwist.com/l8cwrkm92920/LtVogkLE.jpg)

Description:
Now goddess Kylie and Goddess Dava bring poor pathetic loser Eugene into their dungeon to use him for their own pleasure, Eugene helpless to the girls sexy little outfits and hot bodies agrees to do anything the ladies want, and ladies get off on this power and love using men, they strap him up with a dildo gag and instruct him to fuck their young wet pussy_s Bratty Dom kylie removes his glasses telling him they will just fog up anyway and then slides the dildo gag right Dava_s waiting wetness Eugene pumps as hard and fast as he can and Dava cums then it_s right into Goddess Kylie she Fucks his face hard until she reaches orgasm, then they tell him this can be one of the fun games they play every weekend, but not to tell a soul that it is their little secrete, Eugene agrees.
Model:
Dava Foxx, Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : s666eugenechindopt2.mp4
File Size : 669.46 MB
Resolution : 1920x1080
Duration : 00:07:50

Download K2S VIDEO:
Keep2Share Video: s666eugenechindopt2.mp4 (https://k2s.cc/file/2ef946718b23e)

Clit
02-03-2025, 02:59 PM
Clubdom.com- Daisy Ducati & Raven Bay StrapOn
https://img166.imagetwist.com/th/67116/qcuo44p1v4so.jpg (https://imagetwist.com/qcuo44p1v4so/tVyfYBa.jpg)
https://img202.imagetwist.com/th/67116/931me32bao6n.jpg (https://imagetwist.com/931me32bao6n/waaSMnz.jpg)

Description:
Goddess Raven Bay and Daisy Ducati Love to destroy men they have two ass clowns out of their cages today with their lips wrapped around their 13 inch black strapon cocks and inform the _ that they will be getting the ass pounding of their life today, Raven Bay his sadistic and vicious with her Strap On she uses it like a weapon and stretches and rams ass_s like you have never seen goddess Daisy is more the slow and deep type she fills your ass cavity completely until she is balls deep, both woman completely destroy these slaves fucking their gaping holes hard and long even flipping the bitches upside down and ramming them Pyle driver style.
Model:
Daisy Ducati, Raven Bay
Studio:
Clubdom.com
Info:
File Name : s810daisyducatiravenbaystrapon.mp4
File Size : 683.66 MB
Resolution : 1920x1080
Duration : 00:07:56

Download K2S VIDEO:
Keep2Share Video: s810daisyducatiravenbaystrapon.mp4 (https://k2s.cc/file/209696383bb5e)

Clit
02-03-2025, 04:21 PM
Clubdom.com- Michelle & Lydia Battered Balls CBT
https://img119.imagetwist.com/th/67098/71ncbif8mgdl.jpg (https://imagetwist.com/71ncbif8mgdl/dzmNOPA.jpg)
https://img69.imagetwist.com/th/67098/ja2qdd7xila1.jpg (https://imagetwist.com/ja2qdd7xila1/PCakjiuU.jpg)

Description:
Goddess Lydia Supremacy and Mistress Michelle Lacy decide to amuse themselves by destroying their slaves filth sax and pathetic cock. They hang him from their post and start to crop his cock till tears are running down his face. As Goddess Lydia and Mistress Michelle inflict pain on their slave they laugh in his face as he cries for mercy. With their slave whimpering like a pathetic bitch Goddess Lydia digs her claws into his useless cock causing enormous amounts pain.
Model:
Lydia Supremacy, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s698michellelacylydiasupremicycbt.mp4
File Size : 638.34 MB
Resolution : 1920x1080
Duration : 00:07:26

Download K2S VIDEO:
Keep2Share Video: s698michellelacylydiasupremicycbt.mp4 (https://k2s.cc/file/2b388d1acb479)

Clit
02-03-2025, 05:30 PM
Clubdom.com- Venus & Kylie Caning in Dungeon
https://img166.imagetwist.com/th/67080/axbb6pri2hx2.jpg (https://imagetwist.com/axbb6pri2hx2/LDyMWh.jpg)
https://img69.imagetwist.com/th/67080/71i61e775nd3.jpg (https://imagetwist.com/71i61e775nd3/ZYNqpSW.jpg)

Description:
Venus and Kylie have their disobedient slave restrained and are caning his white pasty ass until he learns his lesson.
Model:
Kylie Rogue, Venus Divine
Studio:
Clubdom.com
Info:
File Name : s705venuskyliecaningdungeon.mp4
File Size : 809.08 MB
Resolution : 1920x1080
Duration : 00:09:21

Download K2S VIDEO:
Keep2Share Video: s705venuskyliecaningdungeon.mp4 (https://k2s.cc/file/566c05f2e63c9)

Clit
02-03-2025, 05:55 PM
Clubdom.com- Boot Licking Whore Gets Caned
https://s10.imagetwist.com/th/67098/tsgbd2e690ly.jpg (https://imagetwist.com/tsgbd2e690ly/eFQzbF.jpg)
https://img202.imagetwist.com/th/67098/d939emwpgm6y.jpg (https://imagetwist.com/d939emwpgm6y/gXVLsVe.jpg)

Description:
Boot Licking Whore Gets Caned Goddess Lydia Supremacy and Mistress Michelle Lacy have their slave on his knees where he belongs making this pathetic bitch lick their boots clean from bottom to top. As they humiliate him and talk down to their slave, he licks the soles of their boots while they are sitting on their chariot. Goddess Lydia informs this bitch that he has disappointed his Goddesses and now its time for a canning. They make this worthless slave roll them out to the field where he is to be locked up and destroyed by his Goddesses. With their slave lock in a stockade with no way to escape Goddess Lydia and Mistress Michelle start to cane his ass till he is shacking in pain. They begin to laugh as each Goddess takes turns marking this pathetic slave till they are pleased with their work.
Model:
Lydia Supremacy, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s696michellelacylydiasupremicybootlickcaining.mp4
File Size : 561.83 MB
Resolution : 1920x1080
Duration : 00:06:33

Download K2S VIDEO:
Keep2Share Video: s696michellelacylydiasupremicybootlickcaining.mp4 (https://k2s.cc/file/831e20c3eb4d9)

Clit
02-03-2025, 06:02 PM
Clubdom.com- Michelle Lacy & Natalya Highheel Worship
https://img34.imagetwist.com/th/67059/jn1cwnn89x4l.jpg (https://imagetwist.com/jn1cwnn89x4l/gSnIVJg.jpg)
https://img202.imagetwist.com/th/67059/p8angvccdgep.jpg (https://imagetwist.com/p8angvccdgep/JiLCVZb.jpg)

Description:
Mistress Michelle Lacy and Mistress Natalya Sadici have a job for their pathetic bitch slave. They make him lay on his back as they begin to shove each heel down his throat making this worthless slave gag. As Mistress Michelle and Natalya take turns getting their high heels licked clean. They tell their slave that if he can make their heels shine like new, they might let him play with his pathetic 2 dick. Highly excited, this pathetic loser quickly springs to a kneeling position and beings pulling on his needle dick. As the worthless bitch pumps away at his cockette, both Mistress Lacy and Natalya are overcome with fits of laughter due to the spectacle before them. Grunting and bucking like a wild animal, the slave lustfully pumps his hand-pussy as both Mistresses demand he quickly spill his filth. Eager to obey, this slut whore sprays his disgusting load all over the dungeon floor, making a huge mess. Of course, the Mistresses demand their dungeon be left spotless, grabbing the slave by the hair and mopping up his man-filth with his tongue and face.
Model:
Michelle Lacy, Natalya Sadici
Studio:
Clubdom.com
Info:
File Name : s644michellelacynatalyasadicihighheelworship.mp4
File Size : 439.31 MB
Resolution : 1920x1080
Duration : 00:05:04

Download K2S VIDEO:
Keep2Share Video: s644michellelacynatalyasadicihighheelworship.mp4 (https://k2s.cc/file/e4d4d45e11ede)

Clit
02-03-2025, 06:05 PM
Clubdom.com- Fucked by Michelle Lacy & Lydia
https://img69.imagetwist.com/th/67094/uu33m22szjjy.jpg (https://imagetwist.com/uu33m22szjjy/xNSMSC.jpg)
https://img401.imagetwist.com/th/67094/vvzcwuc1k6qo.jpg (https://imagetwist.com/vvzcwuc1k6qo/hFEbcxws.jpg)

Description:
Mistress Michelle Lacy and Goddess Lydia Supremacy decide that it is time to have some fun shocking their slave Bradlina while making him crawl on all fours like the bitch he is. As Mistress Michelle and Goddess Lydia force this pathetic slave on his back taunting him right before they cattle prod his 2 dick making him scream in agony. Next they bend Bradlina over and tear his man pussy up with their 12 black strap-on cocks. While this worthless slave yells for mercy, Goddess Lydia begins to threaten his face with her cattle prod making him beg for his Mistress to fuck his tight man pussy. Next thing this worthless slave knows, is his now gaping asshole is being pile drived by Mistress Michelle. Never ask for mercy at ClubDom
Model:
Lydia Supremacy, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s697michellelacylydiasupremicycattleprodfucked.mp4
File Size : 431.2 MB
Resolution : 1920x1080
Duration : 00:05:01

Download K2S VIDEO:
Keep2Share Video: s697michellelacylydiasupremicycattleprodfucked.mp4 (https://k2s.cc/file/801e323edcfb5)

Clit
02-03-2025, 06:21 PM
Clubdom.com- Drain and Drink for your Goddesses
https://img119.imagetwist.com/th/67070/0hz306pb1309.jpg (https://imagetwist.com/0hz306pb1309/pKfrTq.jpg)
https://img69.imagetwist.com/th/67070/t0pffqsfg4f7.jpg (https://imagetwist.com/t0pffqsfg4f7/qgKhcc.jpg)

Description:
Goddesses Kylie and Nikki are amused by their two horny slaves who are dying to cum. They know the slaves are turned on by their sexy thigh high boots. They order the slaves to jerk off and.....they have to eat their filth for the Goddesses. How humiliating and degrading
Model:
Kylie Rogue, Nikki Ortega
Studio:
Clubdom.com
Info:
File Name : s651kylieroguenikkiortagabootjerkoff.mp4
File Size : 604.29 MB
Resolution : 1920x1080
Duration : 00:07:03

Download K2S VIDEO:
Keep2Share Video: s651kylieroguenikkiortagabootjerkoff.mp4 (https://k2s.cc/file/346a63a6eb7a2)

Clit
02-03-2025, 06:34 PM
Clubdom.com- Lydia & Kylie Rogue StrapOn POV
https://img69.imagetwist.com/th/67118/7rtwsygtreny.jpg (https://imagetwist.com/7rtwsygtreny/hRUSQxR.jpg)
https://img69.imagetwist.com/th/67118/tigip9bi41r1.jpg (https://imagetwist.com/tigip9bi41r1/MEFQolRd.jpg)

Description:
Crawl over and lick our cocks, we see you panting for it. Your ass is going to be a dick cozey for us today, get ready to be stretched and start touching yourself. keep stroking while we show you how to open wide that slutty mouth to wrap those lips around both our cocks. Don_t stop fingering that manpussy Lydia Supremacy shows you what it would be like to be skull fucked by her and Kylie Rogue shows you what it would be like to fuck your other sluthole, spit roasting you
Model:
Kylie Rogue, Lydia Supremacy
Studio:
Clubdom.com
Info:
File Name : s841lydiasupremacykylieroguestraponpov.mp4
File Size : 470.62 MB
Resolution : 1920x1080
Duration : 00:05:28

Download K2S VIDEO:
Keep2Share Video: s841lydiasupremacykylieroguestraponpov.mp4 (https://k2s.cc/file/964e40427d00b)

Clit
02-03-2025, 06:42 PM
Clubdom.com- Jamie & Kimber- Milking Your Clit Stick POV
https://img34.imagetwist.com/th/67097/8e6a0g2preh7.jpg (https://imagetwist.com/8e6a0g2preh7/bGYuaoUD.jpg)
https://t102.pixhost.to/thumbs/113/557014205_ejwbfnf.jpg (https://pixhost.to/show/113/557014205_ejwbfnf.jpg)

Description:
Goddess Jamie valentine and Kimber Woods know you want to touch that pathetic clit stick and milk it for all its worth, but first you will have to do a few things. You can Start by fucking that gaping man pussy with three fingers, that_s right bitch three ficgers Now the ladies drive you right to the edge by kissing and fondling each other Goddess kimber even licks Jamie_s Huge round tits all while you just stair with three fingers shoved up your ass and a dumb ass look on your face, finally they lets you spray your milky white load all over the floor and tell you to lick it up.
Model:
Jamie Valentine, Kimber Woods
Studio:
Clubdom.com
Info:
File Name : s731jamievalentinekimberwoodspovjoi.mp4
File Size : 618.07 MB
Resolution : 1920x1080
Duration : 00:07:14

Download K2S VIDEO:
Keep2Share Video: s731jamievalentinekimberwoodspovjoi.mp4 (https://k2s.cc/file/1f75eeaeb7b6b)

Clit
02-03-2025, 07:20 PM
Clubdom.com- Kylie & Michelle Lacy- Ass Fag POV
https://img166.imagetwist.com/th/67126/bqhr590vv4cx.jpg (https://imagetwist.com/bqhr590vv4cx/MhDTevte.jpg)
https://img69.imagetwist.com/th/67126/xn8k4cmc7wnp.jpg (https://imagetwist.com/xn8k4cmc7wnp/jPaUrq.jpg)

Description:
Goddess Kylie Rogue and Mistress Michelle Lacy are wearing their 12 inch strap on cocks and are instructing you how to stretch out your slutty little asshole to be ready for them to ram your man pussy hard they even let you stroke that pathetic 2 inch dick while you have three fingers shoved up your slut hole.
Model:
Kylie Rogue, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s850kylieroguemichellelacypov2.mp4
File Size : 127.53 MB
Resolution : 1920x1080
Duration : 00:06:52

Download K2S VIDEO:
Keep2Share Video: s850kylieroguemichellelacypov2.mp4 (https://k2s.cc/file/35aa00b5d1b9f)

Clit
02-03-2025, 07:29 PM
Clubdom.com- Veronica & Kylie Rogue CBT POV
https://img119.imagetwist.com/th/67119/irbyecgx7wt3.jpg (https://imagetwist.com/irbyecgx7wt3/toHUwth.jpg)
https://img69.imagetwist.com/th/67119/syq7x8vtueu8.jpg (https://imagetwist.com/syq7x8vtueu8/jnDMmWeC.jpg)

Description:
You are going to have to earn the permission to spill your filth today Mistress Veronica Cohen wants you to stick your balls out for a proper cbt instruction. Mistress Kylie Rogue demonstrates how fast each blow should be on those filth sacks.They know your slutty hand is ready to reach for that dicklet but you haven_t impressed Veronica yet, so you will be punishing those balls more. you_re such a pain-slut that you are about to spill already, your Mistresses will count you down though, so don_t dare spill a drop earlyv
Model:
Kylie Rogue, Veronica Cohen
Studio:
Clubdom.com
Info:
File Name : s838veronicacohenkylieroguecbtpov.mp4
File Size : 509.47 MB
Resolution : 1920x1080
Duration : 00:05:56

Download K2S VIDEO:
Keep2Share Video: s838veronicacohenkylieroguecbtpov.mp4 (https://k2s.cc/file/c4484c943dec1)

Clit
02-03-2025, 07:35 PM
Clubdom.com- Alexis_s Fuck Monkey Sucks Cock
https://s10.imagetwist.com/th/67099/ho84u18w9k92.jpg (https://imagetwist.com/ho84u18w9k92/hoCxfu.jpg)
https://s10.imagetwist.com/th/67100/b63wiskfkc46.jpg (https://imagetwist.com/b63wiskfkc46/MnONaP.jpg)

Description:
Goddess Alexis Fawx gives her new fuck monkey BlowJob instruction on how to properly suck her 12 inch strap on cock, She shoves it right down his fuck hole laughing as he gags on every inch, She makes him beg as he gargles pathetic spit bubbles, Telling him she wants that spit running down his face as she fucks this bitch_s face even harder, Making him eat her dick and beg for more calling him her manwhore. (Pt 2-4)
Model:
Alexis Fawx
Studio:
Clubdom.com
Info:
File Name : s7893-4alexisfawxstrapontoby.mp4
File Size : 537.97 MB
Resolution : 1920x1080
Duration : 00:06:13

Download K2S VIDEO:
Keep2Share Video: s7893-4alexisfawxstrapontoby.mp4 (https://k2s.cc/file/90e1c2040228f)

Clit
02-03-2025, 07:48 PM
Clubdom.com- Splitting Your Ass Boot Slut POV
https://img202.imagetwist.com/th/67085/bxwlpa1rkgti.jpg (https://imagetwist.com/bxwlpa1rkgti/ITnAWNSo.jpg)
https://img34.imagetwist.com/th/67085/9rjxtmojahz2.jpg (https://imagetwist.com/9rjxtmojahz2/ReXSlJm.jpg)

Description:
Goddess Dava Foxx and Mistress Kate England are strapped up and ready for action, they instruct all you strap on man whores and boot loving _ to go ahead and pull out that tiny pathetic excuse for a dick and take your thumb and index finger and start slowly stroking your tiny dicklet, as you sit there staring at their 12 inch hard black strap-on cocks wishing you could have your ass split wide open and have Goddess ram your man cunt , drooling all over yourself just wishing you could be one of their slaves and be licking your own filth of their shiny black boots, go ahead bitch boy spill your load and clean up every last drop.
Model:
Dava Foxx, Kate England
Studio:
Clubdom.com
Info:
File Name : s744davafoxxkateenglandpov2.mp4
File Size : 354.91 MB
Resolution : 1920x1080
Duration : 00:04:08

Download K2S VIDEO:
Keep2Share Video: s744davafoxxkateenglandpov2.mp4 (https://k2s.cc/file/6c600a59bf8ed)

Clit
02-03-2025, 07:49 PM
Clubdom.com- Cherry & Alina- Draining Slut Sacks
https://img202.imagetwist.com/th/67061/f2k0ln6ymkx0.jpg (https://imagetwist.com/f2k0ln6ymkx0/hITSWwP.jpg)
https://img401.imagetwist.com/th/67061/5qzr0mwlj0ny.jpg (https://imagetwist.com/5qzr0mwlj0ny/LIQAMFK.jpg)

Description:
Goddess Cherry Morgan and Mistress Alina Long realize that it_s been 29 days and it is time to milk their slave who is restrained in a straitjacket to keep him from touching his slut stick. It is very important that all semen is drained from the male bitches on a monthly basis. Besides it doubles as their protein for the month as they are fed their own disgusting man filth. The ladies pull the bitch out of the cage teasing him telling him it_s time to drain those slut sacks. They pin him down and proceed to stroke and edge the slaves cock until he erupts, squirting his filth into Mistress Alina_s hand. She then feeds the bitch his own cum.
Model:
Alina Long, Cherry Morgan
Studio:
Clubdom.com
Info:
File Name : s628cherryalinalongmilking01.mp4
File Size : 637.27 MB
Resolution : 1920x1080
Duration : 00:07:20

Download K2S VIDEO:
Keep2Share Video: s628cherryalinalongmilking01.mp4 (https://k2s.cc/file/cf615920f3ecf)

Clit
02-03-2025, 07:55 PM
Clubdom.com- Time To Whip The Bitch
https://img119.imagetwist.com/th/67114/dym6fstlqy3w.jpg (https://imagetwist.com/dym6fstlqy3w/CxkxBM.jpg)
https://img401.imagetwist.com/th/67114/zctgk2e2q3g5.jpg (https://imagetwist.com/zctgk2e2q3g5/RUYoEO.jpg)

Description:
Goddess Daisy Ducati and Raven Bay decide it_s time to whip a bitch nothing turns Mistress Raven on more than a slaves suffering and pain, This is what makes her pussy wet she taunts the slut to take more and more whiplashes from Goddess Daisy as he screams for mercy, the ladies are sadistic and give him none.
Model:
Daisy Ducati, Raven Bay
Studio:
Clubdom.com
Info:
File Name : s811daisyducatiravenbaywhipthebitch.mp4
File Size : 622.88 MB
Resolution : 1920x1080
Duration : 00:07:08

Download K2S VIDEO:
Keep2Share Video: s811daisyducatiravenbaywhipthebitch.mp4 (https://k2s.cc/file/0a88ebb1b4370)

Clit
02-03-2025, 07:59 PM
Clubdom.com- Pussy Eating Milked Slut
https://img119.imagetwist.com/th/67069/w42dk9zlfc8a.jpg (https://imagetwist.com/w42dk9zlfc8a/pkMbksrc.jpg)
https://img119.imagetwist.com/th/67069/m95kigj373jb.jpg (https://imagetwist.com/m95kigj373jb/ljojrkAZ.jpg)

Description:
It_s mid-afternoon, and Mistresses Cherry Morgan and Alina Long notice that one of their stud-slaves is overdue to be milked. After tying their helpless slave to a table, the Dommes decide that a milking is in order It_s been over 30 days since his last release, and the bitch boy trembles in anticipation. Mistress Alina roughly tugs and yanks on the slaves_ worthless cock while Mistress Cherry Morgan decides to ride his face with her amazonian ass. Not pleased with the slut_s performance, Mistress Cherry Morgan grinds her pussy into his face, using him as nothing more than a tool to achieve her orgasm. Meanwhile, Mistress Alina masterfully pulls the filth out of the underling_s slut stick, which Mistress Cherry gleefully scoops up into her hand and shoves down the manwhore_s throat
Model:
Alina Long, Cherry Morgan
Studio:
Clubdom.com
Info:
File Name : s632cherryalinamilkingandrew.mp4
File Size : 449.37 MB
Resolution : 1920x1080
Duration : 00:05:13

Download K2S VIDEO:
Keep2Share Video: s632cherryalinamilkingandrew.mp4 (https://k2s.cc/file/1b294fa507c12)

Clit
02-03-2025, 08:52 PM
Clubdom.com- Dava Foxx & Kylie StrapOn
https://img166.imagetwist.com/th/67058/htrvpxozca8n.jpg (https://imagetwist.com/htrvpxozca8n/cbroQfp.jpg)
https://img401.imagetwist.com/th/67058/pgckmmcwzvhe.jpg (https://imagetwist.com/pgckmmcwzvhe/Natgwx.jpg)

Description:
Desperate to please their Goddess_s, thees slaves beg for 12_ of hard black cock, The harder the lady_s fuck them , the more gaping there assholes become they turn them into nothing but compliant sex toys for there big hard cocks. Even when the Goddess Dava and Mistress Kylie finish fucking the slaves ass, They are not content until they have totally humiliated thees _ by making them clean their own ass juice off the dildo_s with there slutty mouths.
Model:
Dava Foxx, Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : s622davafoxxkyliestrapon.mp4
File Size : 594.96 MB
Resolution : 1920x1080
Duration : 00:06:52

Download K2S VIDEO:
Keep2Share Video: s622davafoxxkyliestrapon.mp4 (https://k2s.cc/file/6b240c2fc769a)

Clit
02-03-2025, 08:57 PM
Clubdom.com- Lydia & Kylie Rogue Whipping
https://img69.imagetwist.com/th/67118/2xvtl9exhxkq.jpg (https://imagetwist.com/2xvtl9exhxkq/LVqkffbw.jpg)
https://img119.imagetwist.com/th/67118/xj2a2gqm7sw2.jpg (https://imagetwist.com/xj2a2gqm7sw2/GDXIAgv.jpg)

Description:
Mistress Lydia Supremacy and Kylie Rogue take their pet slave out to play. But first he has to beg for their attentions. Beg to be whipped and convince us you want it That is what excites us after all, your quaking legs and guttural screams. Once he is bound into place, Lydia takes her time savoring his reactions while Kylie watches and grows wet from his back arching after each hard lashing. But wait Look at that bare ass, blank and ready to be marked Lydia Looks up at Kylie Laughing Didn_t you want to cane a bitch today?
Model:
Kylie Rogue, Lydia Supremacy
Studio:
Clubdom.com
Info:
File Name : s846lydiasupremacykylieroguewhiping.mp4
File Size : 615.62 MB
Resolution : 1920x1080
Duration : 00:07:11

Download K2S VIDEO:
Keep2Share Video: s846lydiasupremacykylieroguewhiping.mp4 (https://k2s.cc/file/b8dff7f8ec05f)

Clit
02-03-2025, 09:01 PM
Clubdom.com- Veronica Cohen & Kylie Rogue StrapOn 3
https://img202.imagetwist.com/th/67118/pnc913urr695.jpg (https://imagetwist.com/pnc913urr695/aZSDeiEH.jpg)
https://img401.imagetwist.com/th/67118/dposddvqhpcy.jpg (https://imagetwist.com/dposddvqhpcy/cTEidrxf.jpg)

Description:
Mistress Kylie Rogue slips her cock right into the stretched man-pussy of one her most strap-on hungry slaves. She tells Mistress Veronica Cohen that they could probably fit both cocks in at the same time. Since this slave is so well trained, Veronica flips him over and power drives him. She ruthlessly jackhammers into his ass with his legs are strapped open wide like the gaping slut he is.
Model:
Kylie Rogue, Veronica Cohen
Studio:
Clubdom.com
Info:
File Name : s839veronicacohenkylieroguestrapon3.mp4
File Size : 510.83 MB
Resolution : 1920x1080
Duration : 00:05:57

Download K2S VIDEO:
Keep2Share Video: s839veronicacohenkylieroguestrapon3.mp4 (https://k2s.cc/file/b5ba48e342e20)

Clit
02-03-2025, 09:09 PM
Clubdom.com- Raven & Alina Pony Cart Jerkoff
https://img34.imagetwist.com/th/67087/e4pzha9977z9.jpg (https://imagetwist.com/e4pzha9977z9/LndMCmX.jpg)
https://img202.imagetwist.com/th/67087/8yqkqcequg6q.jpg (https://imagetwist.com/8yqkqcequg6q/vmuFmzb.jpg)

Description:
Goddess Alina Long and Raven Bay are still having fun with their new pathetic slave boy the one they found tied to a tree, they made him fuck his way tp freedom by having him fuck a blow-up sheep Then they made him worship their boots and teased him with their pussy_s letting him breathe in their essence but never touching, so now they have decided to go for a pony cart ride and make this poor slave pull them all around the estate and Goddess raven hand the out of breath bitch a teaspoon, and tells him it_s time for his nourishment so he better start stroking that tiny little slut stick and fill the teaspoon up with his filth and then he will eat up every last drop.
Model:
Alina Long, Raven Bay
Studio:
Clubdom.com
Info:
File Name : s7553-3ravenbayalinalongponycartjerkoff.mp4
File Size : 499.3 MB
Resolution : 1920x1080
Duration : 00:05:48

Download K2S VIDEO:
Keep2Share Video: s7553-3ravenbayalinalongponycartjerkoff.mp4 (https://k2s.cc/file/464e397551997)

Clit
02-03-2025, 09:19 PM
Clubdom.com- Cherry & Kylie The Last Milking
https://img69.imagetwist.com/th/67100/vcg2x62rxvug.jpg (https://imagetwist.com/vcg2x62rxvug/XEmFVO.jpg)
https://s10.imagetwist.com/th/67100/67ds1i95isdl.jpg (https://imagetwist.com/67ds1i95isdl/JqWazq.jpg)

Description:
Today Goddess Kylie Rogue and Cherry Morgan pull their slut from his cage, He has not been producing enough filth, So this is his last chance for redemption, Goddess Cherry show the slut a huge syringe filled with a blue fluid, As Cherry injects it into his useless slut sacks Goddess Kylie explains that he has exactly 10 minutes to produce a load because if he doesn_t get it done before then a chemical reaction will occur and his pathetic nuts will disintegrate, shrivel up and just fall off, The ladies laugh and begin giving this slut the last milking of his life,They are mean and sadistic stoking the bitches slut stick hard and fast edging him right to the brink, finally he lets out a big sigh and fills the shot glass with a huge chunky white load of man filth,Goddess Kylie pours it right down his throat.
Model:
Cherry Morgan, Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : s766cherrymorgankylieroguemilking.mp4
File Size : 916.49 MB
Resolution : 1920x1080
Duration : 00:10:40

Download K2S VIDEO:
Keep2Share Video: s766cherrymorgankylieroguemilking.mp4 (https://k2s.cc/file/f22698fe4878c)

Clit
02-03-2025, 09:42 PM
Clubdom.com- Michelle Lacy & Brianna Cum Eater
https://img69.imagetwist.com/th/67054/8chz0weppbvn.jpg (https://imagetwist.com/8chz0weppbvn/SJpEYWIb.jpg)
https://s10.imagetwist.com/th/67054/qxxv9dcdzl51.jpg (https://imagetwist.com/qxxv9dcdzl51/FNYZsiIg.jpg)

Description:
Goddess Brianna and Mistress Michelle Lacy feel sorry for their bitch. Its been over 43 days since he_s had his proper protein. They decide it_s time to milk the slut and feed him his disgusting thick white man cream. Brianna teasing and edging him up to the point that his balls feel like they_re going to explode. Then stopping so the ladies can have a good laugh. Finally she pulls the filth right out of him. Gobs and gobs of disgusting cum squirt out of the pathetic slaves dick. Scooping it up with her black glove she feeds the bitch all of his cum. Michelle gives the bitch a new nickname cum eater
Model:
Goddess Brianna, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s583_michelle_lacy_brianna_hj_cum_eater.mp4
File Size : 547.23 MB
Resolution : 1920x1080
Duration : 00:06:20

Download K2S VIDEO:
Keep2Share Video: s583_michelle_lacy_brianna_hj_cum_eater.mp4 (https://k2s.cc/file/41b7e46199caf)

Clit
02-03-2025, 09:44 PM
Clubdom.com- Jean Bardot & Kylie Strapon Part 5
https://img166.imagetwist.com/th/67053/mdclygtg9d7a.jpg (https://imagetwist.com/mdclygtg9d7a/ZiBXvXjK.jpg)
https://img34.imagetwist.com/th/67053/ka49egbwcpy6.jpg (https://imagetwist.com/ka49egbwcpy6/UjlxUR.jpg)

Description:
Mistresses Jean Bardot and Kylie Rouge have hired Lew and Alex, two repairmen to do some odd jobs around the property today. Imagine the shock to the two Doms when one of the repairmen turns out to be a canceling male chauvinist pig. Despite the protests of his partner Alex, Lew can_t shut his mouth and stop letting his male arrogance get him deeper and deeper in trouble. Even worse, after being given direct orders from Miss Bardot not to enter her private dungeon, the brazen idiot marches right in at first opportunity, considering her warnings a joke. Little did these two repairmen know that the joke would be on them. We next find our repairmen in the dungeon, Alex in a kennel and loudmouth Lew strapped to a milking bench. Goddess Jean Bardot is furious and decides to remove some of Lews testosterone by milking his overactive balls. Both Mistress Kylie and Goddess Jean take turns roughing pulling and milking Lews pig stick as he both moans on pleasure and cries in agony. The Goddess_s to not let up for a second, taunting and tormenting the loudmouth caveman as they pull his cum out of his cock and then force him to eat it. Not satisfied, Goddess Jean unleashes fury of kicks to the repairman_s_ balls, leaving him howling like a wounded as the Goddess_s move on to repairman Alex. Having been the well behaved one, the Goddesses allow Alex a chance to earn his freedom. If the stud can hold his load and fuck Mistress Kylie and make her cum in under 3 minutes he will be allowed to go free. To drive this point home, Mistress Jean demands Alex deeply inhale the scent of Mistress Kylie womanhood. Driven to please his Masters, Alex fucks the Miss Kylie with all the passion he can muster, finally making her quiver in climax. As Alex withdraws, Goddess Jean realizes that Alex came in his condom as well Furious, the Doms teabag Alex_s slutty mouth with the filled scumbag, then humiliate him by dumping his filth out on his face and in his mouth. Mistress Jean promises he will be punished for an unauthorized orgasm. We return to find both Goddesses amusing themselves punishing Alex by shocking him with a cattle prod. Alex jumps and flails wildly, not knowing where the next jolt of electricity will come from. Both Ladies laugh and laugh at the spectical before them, noticing that the repairman is paying close attention to their boots. Taking mercy on the sad little slut, Mistress Kylie Rouge and Jean Bardot allow the worm to lock and kiss their boots. As the boots become shiny through worship, both Dommes notice that Alex is quite turned on by worshipping their boots, and demand he become a little boot bumper. Alex eagerly humps away like a bunny, slamming his hips and cock into Mistress Kylie boots until he can_t hold back and explodes all over them. Amused, Goddess Jean demands Alex link up his filth. Mistress Kylie mentions how turned on she is, and Goddess Jean remembers that they still have a loudmouth slave to punish. Nothing makes Mistress Kylie cum like the pain and agony of a slave, and Goddess Jean delivers in spades on the rude and arrogant hide of Lew. A brutal caning leaves the loudmouths ass covered in multicolored welts as tears roll down the pigs face and his screams fill the air. all this pain and suffering has Miss Kylie on the verge of orgasm, so Goddess Jean switches to a whip to amp up the pain even more. Spine chilling screams echo throughout the club do estate as Lew begs and pleads for mercy while Miss Kyle reaches orgasm due to his pain. To finally drive home the point that men should respect women both Doms Don their 10 inch strap on cocks and destroy both repairman asses. Both are flipped upside down and InsideOut but neither can escape nor gain any mercy from the monster cocks if Mistress Jean and Kylie. Once completely Fucked, both boys are ordered to clean thier asses off the cocks that just pounded their formally virgin holes. Finally satisfied Goddess Jean tells loudmouth Lew to scram, and he quickly runs for his life off property. However, the cure and respectful Alex is offered a spot in the club do stable.
Model:
Jean Bardot, Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : s569_jean_bardot_kylie_rogue_part5.mp4
File Size : 496.04 MB
Resolution : 1920x1080
Duration : 00:05:44

Download K2S VIDEO:
Keep2Share Video: s569_jean_bardot_kylie_rogue_part5.mp4 (https://k2s.cc/file/546f4b0f4417e)

Clit
02-03-2025, 09:53 PM
Clubdom.com- Hope Harper & Marsha May POV
https://img34.imagetwist.com/th/67091/feyzyava6m8l.jpg (https://imagetwist.com/feyzyava6m8l/MKvwbzlq.jpg)
https://img202.imagetwist.com/th/67092/m6jkf6jdefhw.jpg (https://imagetwist.com/m6jkf6jdefhw/PgvPxTwN.jpg)

Description:
Bratty Doms Marsha May and Hope Harper know how pathetic you are and just how bad you want to spill your looser goo, the ladies tease and torment you with their sexy bodies as the lift up their little red school girl skirts and laugh as you stroke that tiny little dickett. The girls count you down from ten and make you lick up all your disgusting man filth.
Model:
Hope Harper, Marsha May
Studio:
Clubdom.com
Info:
File Name : s718hopeharpermarshamaypov.mp4
File Size : 422.7 MB
Resolution : 1920x1080
Duration : 00:04:57

Download K2S VIDEO:
Keep2Share Video: s718hopeharpermarshamaypov.mp4 (https://k2s.cc/file/69cc721d76749)

Clit
02-03-2025, 09:56 PM
Clubdom.com- Venus & Kylie Failed Milking
https://img202.imagetwist.com/th/67081/irt33dpsbwlp.jpg (https://imagetwist.com/irt33dpsbwlp/XygjIsQ.jpg)
https://s10.imagetwist.com/th/67081/5mja0g690hhn.jpg (https://imagetwist.com/5mja0g690hhn/ZsLVtUXq.jpg)

Description:
Venus and Kylie think they should feed their starving slave with a big helping of protein, but decide to starve him since he won_t produce any filth from his slut sacks.
Model:
Kylie Rogue, Venus Divine
Studio:
Clubdom.com
Info:
File Name : s707venuskyliecbtfailedhj.mp4
File Size : 530.71 MB
Resolution : 1920x1080
Duration : 00:06:10

Download K2S VIDEO:
Keep2Share Video: s707venuskyliecbtfailedhj.mp4 (https://k2s.cc/file/86a9066c75307)

Clit
02-03-2025, 10:27 PM
Clubdom.com- Rilynn & Roxi Wrestling Humiliation
https://img202.imagetwist.com/th/67086/q3hv5761gbkz.jpg (https://imagetwist.com/q3hv5761gbkz/uIXrMsuI.jpg)
https://img119.imagetwist.com/th/67086/cmajd26ftgl1.jpg (https://imagetwist.com/cmajd26ftgl1/NULtXa.jpg)

Description:
Tiny Dick and his friend Tinnier Dick are on the mat training for a new wrestling competition. Being pathetic and horrible at it, but they have their new masks and think they are the shit. Goddess Roxii Blair and Rilynn Rae come to work out too. The boys tell them that women have no place on the mat and that they_re going to become the new wrestling stars. The girls claim that they are here to work out for the trial also and it_s their time to use the mat. Rilynn recognises tiny dick your tiny dick he says, no I_m not, he is It is hard to tell because both boys have tiny dicks. As a challenge, the ladies want a wrestling match and whoever wins gets to use the mat. Of course, these boys are pathetic and the women beat them easily. Locking their heads between their legs, rubbing their pussies in their face and teasing them by pulling down their pants making fun of their tiny pathetic dicks. What is that? The boys walk away in shame as girls start to feel sorry for them and devise a plan.
Model:
Rilynn Rae, Roxii Blair
Studio:
Clubdom.com
Info:
File Name : s6821-2rilynnraeroxiiblairwrestling.mp4
File Size : 548.07 MB
Resolution : 1920x1080
Duration : 00:06:24

Download K2S VIDEO:
Keep2Share Video: s6821-2rilynnraeroxiiblairwrestling.mp4 (https://k2s.cc/file/a795d2d1ceaba)

Clit
02-03-2025, 10:33 PM
Clubdom.com- Alexis Fawx Strapon Fucking
https://img202.imagetwist.com/th/67098/d5n3rq2bd5wk.jpg (https://imagetwist.com/d5n3rq2bd5wk/GnrUsJp.jpg)
https://img69.imagetwist.com/th/67098/yjs73yttrndv.jpg (https://imagetwist.com/yjs73yttrndv/dqktgzJj.jpg)

Description:
Alexis Fawx Has her pathetic ass slut Toby on his knees with a spit gag in his fuck hole She knows what a cock whore he is and is ready to tell him exactly what she plans to do to his wet waiting asshole, She calls him her fuck monkey and dresses him up makes him suck her hard black strap on cock and spits into his mouth and makes him beg her to fuck his man pussy, Then she turns her attention to you the viewer and lets you stroke that tiny pathetic excuse for a dick you have, and then tells you to spill your load and lube up your ass with it, now take your three fingers and fuck yourself slut. (Part 1 of 4)
Model:
Alexis Fawx
Studio:
Clubdom.com
Info:
File Name : s7891-4alexisfawxstraponpov.mp4
File Size : 386.61 MB
Resolution : 1920x1080
Duration : 00:04:29

Download K2S VIDEO:
Keep2Share Video: s7891-4alexisfawxstraponpov.mp4 (https://k2s.cc/file/7f11edaf64146)

Clit
02-03-2025, 10:42 PM
Clubdom.com- Esmi, Marsha May POV
https://img202.imagetwist.com/th/67057/mmn1v2ikbdi4.jpg (https://imagetwist.com/mmn1v2ikbdi4/iBSzQR.jpg)
https://img401.imagetwist.com/th/67057/3xqspv3kr34m.jpg (https://imagetwist.com/3xqspv3kr34m/sFGSuOR.jpg)

Description:
Goddess Esmi and Mistress May tease you by encouraging you to touch your pathetic slut stick. Stroking your hard little 2 inch dick while you stare at their sexy bodies. Esmi teases you more by lifting up Mistress Mays little black skirt. Showing you her perfect beautiful ass knowing how you wish and yearn to touch it. You are so pathetic. They instruct you to continue to stroke your slut stick till you spill your man filth all over the floor. Then tell you to lick up every last drop.
Model:
Esmi Lee, Marsha May
Studio:
Clubdom.com
Info:
File Name : s614esmimarshamaypov.mp4
File Size : 526.6 MB
Resolution : 1920x1080
Duration : 00:06:03

Download K2S VIDEO:
Keep2Share Video: s614esmimarshamaypov.mp4 (https://k2s.cc/file/64d09ac88c79f)

Clit
02-03-2025, 10:55 PM
Clubdom.com- Ripped Open With KNUCKLE COCK
https://img166.imagetwist.com/th/67084/asloqnlsqqxz.jpg (https://imagetwist.com/asloqnlsqqxz/LbtDyadh.jpg)
https://img69.imagetwist.com/th/67084/8qpjz3gpt498.jpg (https://imagetwist.com/8qpjz3gpt498/wFqHEJP.jpg)

Description:
Goddess Dava FoXX and Kate England Decide it_s time to rip some asshole. to fuck some man pussy, to stretch out your pathetic cock hungry ass The woman are sadistic as they brandish a pair of brass knuckles with a 12_ cock attached, they fuck their slave silly making him beg for every inch then have him clean his filthy ass off the dildo with his mouth, Goddess Kate makes the bitch thank them and lights a cigarette as the ladies just laugh at what a gaping asswhore he is, This Bitch just got knuckle FUCKED
Model:
Dava Foxx, Kate England
Studio:
Clubdom.com
Info:
File Name : s742davafoxxkateenglandknucklefucked.mp4
File Size : 573.08 MB
Resolution : 1920x1080
Duration : 00:06:40

Download K2S VIDEO:
Keep2Share Video: s742davafoxxkateenglandknucklefucked.mp4 (https://k2s.cc/file/7ca6deac4a443)

Clit
02-03-2025, 10:55 PM
Clubdom.com- Michelle Lacy & Natalya Strapon Fuck
https://s10.imagetwist.com/th/67070/9p3ironifrke.jpg (https://imagetwist.com/9p3ironifrke/aNBvvgk.jpg)
https://img202.imagetwist.com/th/67070/222t75ofdz1n.jpg (https://imagetwist.com/222t75ofdz1n/khObhhOY.jpg)

Description:
Mistress Michelle Lacy and Mistress Natalya Sadici are eager to stretch out slave 7s man pussy. As they stand over their slaves cage with their 12 cocks the mistresss tease 7 about how much he wants it and how wide his man pussy must be now. Mistress Michelle and Natalya pull there pathetic bitch out of his cage and make him lube up there cocks with his fuck hole. Thats right 7 lube it up good because we are going to pound your ass into oblivion. Then Mistress Natalya bends her worthless slave over his cage and begins to give him a pounding he wont forget. Then just before he thinks it might be over, Mistress Michelles turn is up. 7 cries and begs for it to end as Mistress Michelle and Mistress Natalya just laugh and inform this pitiful slave that his day is just beginning.
Model:
Michelle Lacy, Natalya Sadici
Studio:
Clubdom.com
Info:
File Name : s647michellelacynatalyasadici.mp4
File Size : 605.54 MB
Resolution : 1920x1080
Duration : 00:06:56

Download K2S VIDEO:
Keep2Share Video: s647michellelacynatalyasadici.mp4 (https://k2s.cc/file/2c206d63704ad)

Clit
02-03-2025, 10:59 PM
Clubdom.com- Alexis & Dava Caning Your Slutty Ass
https://img166.imagetwist.com/th/67114/dn0dg9oat7nf.jpg (https://imagetwist.com/dn0dg9oat7nf/jODXgu.jpg)
https://s10.imagetwist.com/th/67114/q4ml9yhn6p4z.jpg (https://imagetwist.com/q4ml9yhn6p4z/yWoGjVY.jpg)

Description:
Goddess Dava Foxx and Alexis Fawx just love getting a good workout, After warming up they really get down to business sadistically canning your pathetic slutty ass until you whimper and cry begging them to stop, This only turns them on even more as Goddess Alexis straddles you and holds you still while Goddess Dava canes you even harder and longer welting you and turning your ass red as a rose.
Model:
Alexis Fawx, Dava Foxx
Studio:
Clubdom.com
Info:
File Name : s814alexisfawxdavafoxxcaining.mp4
File Size : 658.29 MB
Resolution : 1920x1080
Duration : 00:07:38

Download K2S VIDEO:
Keep2Share Video: s814alexisfawxdavafoxxcaining.mp4 (https://k2s.cc/file/1aadcb5600355)

Clit
02-03-2025, 11:31 PM
Clubdom.com- Lydia Supremacy & Kylie Rogue Caning
https://img34.imagetwist.com/th/67117/z1wnzwdg3kbt.jpg (https://imagetwist.com/z1wnzwdg3kbt/mXTrBdzj.jpg)
https://img119.imagetwist.com/th/67117/qbnsq7kma0jw.jpg (https://imagetwist.com/qbnsq7kma0jw/JnqOmkAJ.jpg)

Description:
A proper slave would have cleaned the carpet correctly the first time he was ordered. Mistress Lydia Supremacy is not impressed with this maggot_s cleaning work, however. She orders him to bring it outside and after inviting Kylie Rogue to Join her, binds his hands as he kneels over the carpet. Their canes are going to be worn out today Lydia wastes no time delivering severe blows on the slave_s ass while he is told to analyze the carpet_s filthy state while he gets disciplined. having nothing to keep him up during the cruel caning, the slave falls over repeatedly from the excruciating slams on his welted ass, which amuses his Mistresses into doing their worst. The punishing strokes leave his ass marked red and swollen, Lydia examines the marks and the slave_s trembling legs, deciding she isn_t satisfied and will hold him in place while Kylie continues his lesson...Mercilessly
Model:
Kylie Rogue, Lydia Supremacy
Studio:
Clubdom.com
Info:
File Name : s842lydiasupremacykylieroguecaning.mp4
File Size : 461.08 MB
Resolution : 1920x1080
Duration : 00:05:21

Download K2S VIDEO:
Keep2Share Video: s842lydiasupremacykylieroguecaning.mp4 (https://k2s.cc/file/d0e7c544004f1)

Clit
02-04-2025, 12:05 AM
Clubdom.com- Esmi, Marsha May Milking
https://img69.imagetwist.com/th/67057/c9ts49w0li9m.jpg (https://imagetwist.com/c9ts49w0li9m/uBmaASd.jpg)
https://img69.imagetwist.com/th/67057/5gbwye689j31.jpg (https://imagetwist.com/5gbwye689j31/MSVgXz.jpg)

Description:
Goddess Esmi Lee and Mistress May can not decide whether they want to fuck or cane this bitch. So they fill his mouth full of cock while caning him. That_s okay. I_ll warm the bitch up., Goddess Esmi taunts, then he_ll be begging for cock Sadistic and brutal Goddess Esmi canes his ass severely until wearing the bitch_s ass out. She wastes no time in bending him over so that Mistress May can straddle the bitch like a pony. They Fuck him hard and wear his pathetic ass out once again, before Mistress May demands he flip over. I want a shot at that mam Pussy She says. She pile drives him and tells him to take all of her 12 inch black cock til he is squealing like a little pig. Your day has just begun... The ladies laugh.
Model:
Esmi Lee, Marsha May
Studio:
Clubdom.com
Info:
File Name : s615esmimarshamaymilking.mp4
File Size : 716.76 MB
Resolution : 1920x1080
Duration : 00:08:19

Download K2S VIDEO:
Keep2Share Video: s615esmimarshamaymilking.mp4 (https://k2s.cc/file/31435a803c29a)

Clit
02-04-2025, 12:13 AM
Clubdom.com- Jamie & Kimber- Dreaming of Black Cock POV
https://img69.imagetwist.com/th/67085/gp4yr3f4mjab.jpg (https://imagetwist.com/gp4yr3f4mjab/yUaxKzgZ.jpg)
https://s10.imagetwist.com/th/67086/6cjip0wgymp9.jpg (https://imagetwist.com/6cjip0wgymp9/aUqWgGKA.jpg)

Description:
Mistress Jamie Valentine and Goddess Kimber Woods Are strapped up with 12_ inches of Black cock and instruct you to jerk off that little pathetic slut stick of yours, As you dream of them ramming your tight little man-pussy with their huge hard cocks laughing as you beg to be fucked harder and deeper like the ass whore that you are, Pathetic always dreaming and longing for Big Black cock.
Model:
Jamie Valentine, Kimber Woods
Studio:
Clubdom.com
Info:
File Name : s729jamievalentinekimberwoodspov.mp4
File Size : 632.23 MB
Resolution : 1920x1080
Duration : 00:07:17

Download K2S VIDEO:
Keep2Share Video: s729jamievalentinekimberwoodspov.mp4 (https://k2s.cc/file/2305e3c048dfe)

Clit
02-04-2025, 12:15 AM
Clubdom.com- Teasing Bratts Part 1
https://s10.imagetwist.com/th/67080/3qd5326022xv.jpg (https://imagetwist.com/3qd5326022xv/xUGyQxj.jpg)
https://img69.imagetwist.com/th/67080/t56ry37p9vew.jpg (https://imagetwist.com/t56ry37p9vew/SKXjgedM.jpg)

Description:
Bratty Doms Kylie Rogue and Dava Foxx notice that Eugene was jerking off his pathetic dick in the garage, so they decide to sneak up on him. He gets so scared that he trips over himself trying to hide the evidence. Mistress Kylie and Dava decide to have a little fun with this nerdy loser. They force him in the cage he was supposedly cleaning. And with this loser locked in a cage now, Mistress Kylie and Dava decide to tease him and make him smell their tight pink pussies and beautiful asses. With this being the closest to a pussy before for Eugene, he has no idea he is about to become Mistress Dava and Kylies pathetic bitch. (Pt 1 of 2 )
Model:
Dava Foxx, Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : s665eugeneteasebrattspt1.mp4
File Size : 651.35 MB
Resolution : 1920x1080
Duration : 00:07:31

Download K2S VIDEO:
Keep2Share Video: s665eugeneteasebrattspt1.mp4 (https://k2s.cc/file/e306ef7db47d6)

Clit
02-04-2025, 12:17 AM
Clubdom.com- Goddesses Worthless Fuck Toy
https://img119.imagetwist.com/th/67071/hlwvp2r866w9.jpg (https://imagetwist.com/hlwvp2r866w9/NIbcGv.jpg)
https://img202.imagetwist.com/th/67071/zirrvu2pd6qr.jpg (https://imagetwist.com/zirrvu2pd6qr/koWuDdra.jpg)

Description:
Mistress Kyile Rogue and Goddess Nicki Ortaga decide they want to have some fun with their worthless slave. As Goddess Nicki pulls on this slaves filth sacs by the rope they are tied to, Mistress Kylie decides to make this bitch fuck her tight pink pussy with a chindo strapped to his fuck hole. Mistress Kylie starts to ride her slaves face till she has an explosive orgasm, meanwhile Goddess Nicki strokes and pulls on his filth sacs instructing him he better not release his filth before Mistress Kylie is done with his face. After Mistress Kylie has had her orgasm, they both start to tease this worthless good for nothing bitch till he emptys his filth all over. Soon after, Goddess Nicki and Mistress Kylie gather his filth, pull off his chindo and make him eat all his filth since he is looking a little underweight.
Model:
Kylie Rogue, Nikki Ortega
Studio:
Clubdom.com
Info:
File Name : s654kylieroguenikkiortagaedging.mp4
File Size : 1032.19 MB
Resolution : 1920x1080
Duration : 00:11:59

Download K2S VIDEO:
Keep2Share Video: s654kylieroguenikkiortagaedging.mp4 (https://k2s.cc/file/6f2f57d293ad0)

Clit
02-04-2025, 12:21 AM
Clubdom.com- Veronica Cohen & Kylie Rogue Caning 2
https://s10.imagetwist.com/th/67117/4jehyt63ti56.jpg (https://imagetwist.com/4jehyt63ti56/jiBVkXvT.jpg)
https://s10.imagetwist.com/th/67117/37o5i2fzz44i.jpg (https://imagetwist.com/37o5i2fzz44i/arRCSd.jpg)

Description:
ClubDom, In Our World Women Rule. Mistress Cheyenne has got her slave by the balls and isn_t going to let him off easy It_s ball busting time In Our World ..
Model:
Goddess Cheyenne, Lydia Supremacy
Studio:
Clubdom.com
Info:
File Name : s835veronicacohenkylieroguecaning.mp4
File Size : 828.31 MB
Resolution : 1920x1080
Duration : 00:09:33

Download K2S VIDEO:
Keep2Share Video: s835veronicacohenkylieroguecaning.mp4 (https://k2s.cc/file/2fb997a7db214)

Clit
02-04-2025, 12:47 AM
Clubdom.com- Kylie Stuffs Her Slave_s Man-Pussy
https://img401.imagetwist.com/th/67116/vp5srgc2tc31.jpg (https://imagetwist.com/vp5srgc2tc31/PYhiMKq.jpg)
https://img34.imagetwist.com/th/67117/m3idzlbh5iv2.jpg (https://imagetwist.com/m3idzlbh5iv2/bDPQmdVt.jpg)

Description:
After being thanked for the caning, Mistress Kylie Rogue has her shoes being licked clean while she chooses which slut hole on her slave to fill first. Bending over her bitch she takes her time feeling every inch that she anally stretches her strap on slut. Feeling his filthy man-pussy taking it all in she pounds against his caned ass and moans when hearing him suffer. Her cock Hungry strap-on slut is careful to be still for his fucking and takes it all while keeping his ass spread wide for her. His ass fucking is just getting warmed up while she tells him I love to hear you grunting like the little pain slut you are...
Model:
Dahlia Rain, Goddess Tangent
Studio:
Clubdom.com
Info:
File Name : cds826kyliejamiestrapon.mp4
File Size : 461.21 MB
Resolution : 1920x1080
Duration : 00:05:22

Download K2S VIDEO:
Keep2Share Video: cds826kyliejamiestrapon.mp4 (https://k2s.cc/file/54041406a50a6)

Clit
02-04-2025, 12:51 AM
Clubdom.com- Dava Foxx & Kate Caning
https://img119.imagetwist.com/th/67083/93yjzejrgho9.jpg (https://imagetwist.com/93yjzejrgho9/RzzxegB.jpg)
https://s10.imagetwist.com/th/67083/rdq22hbd5lmw.jpg (https://imagetwist.com/rdq22hbd5lmw/FMqlQBeS.jpg)

Description:
Goddess Dava Foxx and Kate England are upset their useless slave isn_t stretching his pathetic cock and balls. To punish him they administer a caning on his pale white ass.
Model:
Dava Foxx, Kate England
Studio:
Clubdom.com
Info:
File Name : s739davafoxxkateenglandcaning.mp4
File Size : 699.12 MB
Resolution : 1920x1080
Duration : 00:08:05

Download K2S VIDEO:
Keep2Share Video: s739davafoxxkateenglandcaning.mp4 (https://k2s.cc/file/95f836f15c222)

Clit
02-04-2025, 01:08 AM
Clubdom.com- Veronica Cohen BootLick
https://img202.imagetwist.com/th/67116/0sk6sgvog56q.jpg (https://imagetwist.com/0sk6sgvog56q/mZpBEcO.jpg)
https://img69.imagetwist.com/th/67116/qsb27xuztx26.jpg (https://imagetwist.com/qsb27xuztx26/LPVksF.jpg)

Description:
Suck it, Slave Don_t you Dare lick anywhere but where I permit you to. Veronica Cohen leisurely stretches out her divine legs while her slave sucks on her heel. Finding her shoes not shiny enough she decides to crop his filth sacks every time he does not meet her standards. If only that too, did not arouse her shoe polishing slut. Licking desperately while not moving a muscle under his Goddesses boot, The slave watches as Goddess Veronica presses her platform against his mouth. Now she wants to see the dirt from the bottom of her shoe swallowed, open wide and show her you_ve eaten it all.
Model:
Veronica Cohen
Studio:
Clubdom.com
Info:
File Name : s831veronicacohenkylieroguebootlick.mp4
File Size : 580.89 MB
Resolution : 1920x1080
Duration : 00:06:45

Download K2S VIDEO:
Keep2Share Video: s831veronicacohenkylieroguebootlick.mp4 (https://k2s.cc/file/6e1054520b123)

Clit
02-04-2025, 01:36 AM
Clubdom.com- Callie Calypso Pine Cone
https://img119.imagetwist.com/th/67099/mx8pjhs7o3qu.jpg (https://imagetwist.com/mx8pjhs7o3qu/upUKJx.jpg)
https://s10.imagetwist.com/th/67099/2ubty7wemylj.jpg (https://imagetwist.com/2ubty7wemylj/gHdSflFM.jpg)

Description:
Goddess Callie Calypso knows how muck you want her to stretch out that man pussy of yours, You would like her to walk right up to your cage in her sexy thigh high black boots, wearing her 13 inch hard black strap on cock and pull you out, Make you grab your ankles and shove her huge dick right up your slut hole, Then allow you to clean your own ass off her wet drippy cock, She has other ideas slut, She holds up a pinecone and informs you that once you_re able to shove the whole thing up your ass, Then maybe, just maybe she will come back and fuck you.
Model:
Callie Calypso
Studio:
Clubdom.com
Info:
File Name : s781calliecalypsopinecone.mp4
File Size : 448.81 MB
Resolution : 1920x1080
Duration : 00:05:11

Download K2S VIDEO:
Keep2Share Video: s781calliecalypsopinecone.mp4 (https://k2s.cc/file/6d9db4e346620)

Clit
02-04-2025, 01:44 AM
Clubdom.com- Jerk That Tiny Dicklett Slave Boy
https://img34.imagetwist.com/th/67099/entgcik1toly.jpg (https://imagetwist.com/entgcik1toly/AHlVfpBA.jpg)
https://s10.imagetwist.com/th/67099/c26dj5difrys.jpg (https://imagetwist.com/c26dj5difrys/EEwuXToq.jpg)

Description:
Goddess Dava Foxx knows what a jerk off slut you are and decides to have some fun teasing you today slave, She rubs her sexy body even touching her pussy knowing you can only dream of her, She instructs you to take out that pathetic slut stick and go ahead and jerk it off first slow, Then fast, She loves controlling you, Then finally lets you blow your white chunky load all over yourself, then she makes you scoop up every last drop and swallow it.
Model:
Dava Foxx
Studio:
Clubdom.com
Info:
File Name : s775davafoxxjerkoffpov.mp4
File Size : 530.66 MB
Resolution : 1920x1080
Duration : 00:06:10

Download K2S VIDEO:
Keep2Share Video: s775davafoxxjerkoffpov.mp4 (https://k2s.cc/file/693092f30ab54)

Clit
02-04-2025, 01:53 AM
Clubdom.com- Kendra & Alexis Grace Caning
https://img34.imagetwist.com/th/67053/l6ca3d9efxy7.jpg (https://imagetwist.com/l6ca3d9efxy7/FAkfupa.jpg)
https://img202.imagetwist.com/th/67053/pb8so9i806uc.jpg (https://imagetwist.com/pb8so9i806uc/GRahQwCd.jpg)

Description:
Mistress Kendra and Goddess Alexis Grace plan to have a little fun with their slaves today. Slave 1 is instructed to fuck Goddess Alexis Grace until she has multiple orgasms while Mistress Kendra canes slave 2. All the while knowing the only thing that gets Mistress off is the more pain inflicted onto the slave the hotter she gets. Kendra has no trouble showing him no mercy. Canning stroke after stroke she welts the slaves ass. Continuing harder and faster the Goddess Alexis cums. Slave three locked in his cage is horrified at what is going on. Terrified that he may be next. But which position will he fill?
Model:
Alexis Grace, Kendra James
Studio:
Clubdom.com
Info:
File Name : s570_kendra_alexis_grace_caning_bg.mp4
File Size : 567.41 MB
Resolution : 1920x1080
Duration : 00:06:34

Download K2S VIDEO:
Keep2Share Video: s570_kendra_alexis_grace_caning_bg.mp4 (https://k2s.cc/file/ab76effd2d0e2)

Clit
02-04-2025, 02:09 AM
Clubdom.com- Jamie & Kylie Cane Your Slutty Ass
https://img34.imagetwist.com/th/67115/i75dezl25y0m.jpg (https://imagetwist.com/i75dezl25y0m/owHnFNr.jpg)
https://s10.imagetwist.com/th/67116/id48623frdbs.jpg (https://imagetwist.com/id48623frdbs/hmpyMdWE.jpg)

Description:
Mistress Jamie Valentine and goddess Kylie Rogue are in the mood to administer some punishment, So they pull their slave from his cage and make him beg to be canned, Goddess Kylie tell the slut that it is for his own good, And that this is what pleases her so he better convince her he wants it, The ladies are cruel and sadistic caning the _ ass for over nine minutes. Leaving the slut broken and welted.
Model:
Jamie Valentine, Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : s825kyliejamiecaning.mp4
File Size : 829.25 MB
Resolution : 1920x1080
Duration : 00:09:37

Download K2S VIDEO:
Keep2Share Video: s825kyliejamiecaning.mp4 (https://k2s.cc/file/04f2c145e1316)

Clit
02-04-2025, 02:28 AM
Clubdom.com- Marina & Angel- The Joy of Caning Slave 227
https://img34.imagetwist.com/th/67054/dkeuin1n2mds.jpg (https://imagetwist.com/dkeuin1n2mds/EXakvz.jpg)
https://img202.imagetwist.com/th/67055/jniwkvp8yki8.jpg (https://imagetwist.com/jniwkvp8yki8/zgqVgFg.jpg)

Description:
Mistress Marina Angel and Mistress Molly Jane feel like getting their workout today. So they pull their bitch out of his cage putting him in a ball stock and proceed to cane his ass. They make a game out of if as he is made to count every cane stroke which is striking him so fast that he loses count. He now has to start over again. The ladies are amused at the power they have over this this bitch. Mistress Molly then informs him this is just the warm-up. We are getting your ass nice and ready for my big black strap on. Mistress Marina tells him one way or the other your ass belongs to us.
Model:
Marina Angel, Molly Jane
Studio:
Clubdom.com
Info:
File Name : s590marinaangelcaning.mp4
File Size : 551.9 MB
Resolution : 1920x1080
Duration : 00:06:23

Download K2S VIDEO:
Keep2Share Video: s590marinaangelcaning.mp4 (https://k2s.cc/file/7c2b932e2d40f)

Clit
02-04-2025, 02:29 AM
Clubdom.com- Kylie Rogue & Jamie Strapon
https://img401.imagetwist.com/th/67056/orpjfs6i5c1v.jpg (https://imagetwist.com/orpjfs6i5c1v/YywTVv.jpg)
https://img166.imagetwist.com/th/67057/5qavqs7rtato.jpg (https://imagetwist.com/5qavqs7rtato/bkhlXW.jpg)

Description:
Goddess Jamie Valentine and Mistress Kylie Rogue instruct their slaves to clean the dungeon and over hear one of the slaves complaining that all they ever do is clean. She smacks the bitch right to his knees and sticks her 12 inch black strap on cock right in his throat. Telling him now you_re going to clean this bitch She starts gagging him and informs him that this will be the only lubrication used to fuck his tight little man pussy. Mistress Kylie and Jamie destroy these bitches asses. Thrusting their 12cocks deep inside the slaves anal cavity making them beg for every inch. After they have fucked these bitches hard and long they inform them that they will now finish cleaning the dungeon and be thankful for serving goddesses.
Model:
Jamie Valentine, Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : s610kylieroguejamievalentinestrapon.mp4
File Size : 572.01 MB
Resolution : 1920x1080
Duration : 00:06:37

Download K2S VIDEO:
Keep2Share Video: s610kylieroguejamievalentinestrapon.mp4 (https://k2s.cc/file/452558b51ab24)

Clit
02-04-2025, 02:33 AM
Clubdom.com- Esmi & Marsha May Strapon Fucking 2
https://img202.imagetwist.com/th/67057/ho62jg52d0un.jpg (https://imagetwist.com/ho62jg52d0un/HSwJnAyn.jpg)
https://img34.imagetwist.com/th/67058/24e0r5cfkwoq.jpg (https://imagetwist.com/24e0r5cfkwoq/TdXJsU.jpg)

Description:
Goddess Esmi and Mistress May decide its time to double stuff this bitch. They make their slave Toby beg for big hard black cock. First they shove all 12 inches in his mouth telling him that will be the only lubrication used to fuck his man pussy. The more he protests the harder Goddess Esmi fucks him. The slave starts tying to creep away from the cock in his ass and she grabs him by his hips and slams him back down. Thrusting even deeper while Mistress May shoves all 12 inches of her black cock in the bitches mouth. The more he cries the harder he gets fucked.
Model:
Esmi Lee, Marsha May
Studio:
Clubdom.com
Info:
File Name : s617esmimarshamaystrapon.mp4
File Size : 515.71 MB
Resolution : 1920x1080
Duration : 00:05:59

Download K2S VIDEO:
Keep2Share Video: s617esmimarshamaystrapon.mp4 (https://k2s.cc/file/a7ce77e6bf23e)

Clit
02-04-2025, 02:40 AM
Clubdom.com- Venus & Kylie Caning Tiedup Man
https://img34.imagetwist.com/th/67080/lvnfxd2uadp0.jpg (https://imagetwist.com/lvnfxd2uadp0/CAteWQ.jpg)
https://img202.imagetwist.com/th/67081/fkrlt1gvj422.jpg (https://imagetwist.com/fkrlt1gvj422/UEbytE.jpg)

Description:
Venus and Kylie have their slave tied and bound and proceed to can his lily white ass until bright red and nearly bleeding.
Model:
Kylie Rogue, Venus Divine
Studio:
Clubdom.com
Info:
File Name : s704venuskyliecaning.mp4
File Size : 806.12 MB
Resolution : 1920x1080
Duration : 00:09:15

Download K2S VIDEO:
Keep2Share Video: s704venuskyliecaning.mp4 (https://k2s.cc/file/bb5a1e1105ff5)

Clit
02-04-2025, 03:00 AM
Clubdom.com- Callie Calypso Lick it Up
https://img401.imagetwist.com/th/67099/s3sf43ydr4lt.jpg (https://imagetwist.com/s3sf43ydr4lt/aLLWVTGh.jpg)
https://img34.imagetwist.com/th/67099/4e7ixkeb7fjg.jpg (https://imagetwist.com/4e7ixkeb7fjg/NEuwKmcZ.jpg)

Description:
Goddess Calypso walks you in on your leash, puts you on your knees right in front of her thigh high black stiletto boots and instructs you to take out your tiny 3 inch dick and then shows you that she has a tint pathetic 3 inch dick also, She spits on the dildo and starts to stroke it and teaches you how to jerk off properly as she edges you right the point of cumming then stops you. And just laughs at you, Then she builds you up again stroking it fast then faster and just like that you squirt a huge load of man filth all over the floor, She grabs your head and forces it down instructing you to slurp up every disgusting drop.
Model:
Callie Calypso
Studio:
Clubdom.com
Info:
File Name : s780calliecalypsolickitup.mp4
File Size : 506.19 MB
Resolution : 1920x1080
Duration : 00:05:51

Download K2S VIDEO:
Keep2Share Video: s780calliecalypsolickitup.mp4 (https://k2s.cc/file/5c648f48630a5)

Clit
02-04-2025, 03:02 AM
Clubdom.com- Veronica Cohen StrapOn Worship
https://s10.imagetwist.com/th/67117/fkes0n9wtkve.jpg (https://imagetwist.com/fkes0n9wtkve/Fsphao.jpg)
https://img34.imagetwist.com/th/67117/pmy4k79co4ko.jpg (https://imagetwist.com/pmy4k79co4ko/DPtXAAyY.jpg)

Description:
You know why I_m having you get this cock wet right, slave boy? To stick in that little pussy-ass of yours. Veronica is cruel with her fucking. She patiently lets her Slave slobber on her cock since she is seconds away from filling his man-pussy deep. all his grunting only excites her more, she grips his hips and pounds into him.Drilling his slut hole mercilessly, she slaps his ass while demanding he thank her for her cock. She isn_t done yet, though. Now he has to suck all his filth off of it. Take that cock
Model:
Veronica Cohen
Studio:
Clubdom.com
Info:
File Name : s834veronicacohenkylieroguestrapon.mp4
File Size : 521.79 MB
Resolution : 1920x1080
Duration : 00:06:05

Download K2S VIDEO:
Keep2Share Video: s834veronicacohenkylieroguestrapon.mp4 (https://k2s.cc/file/032a27eb18abd)

Clit
02-04-2025, 03:16 AM
Clubdom.com- Michelle Lacy & Natalya POV
https://img119.imagetwist.com/th/67069/w4lre9anzgx5.jpg (https://imagetwist.com/w4lre9anzgx5/kccgYF.jpg)
https://img401.imagetwist.com/th/67069/gafpg4sjojqs.jpg (https://imagetwist.com/gafpg4sjojqs/iFgdnM.jpg)

Description:
Mistress Michelle Lacy and Natalya Sadici laugh at the pathetic slave as he stares at their shiny black outfits and sexy shoes wishing he could touch hid pathetic 2 inch slut stick. The ladies first instruct him to smack himself in the balls hard at least 10 times. Then he must take three fingers and shove them up his pathetic asshole. When he_s drooled enough on the floor they give him permission to jerk his 2 inch dicklet. Finally, the countdown begins, 5-4-3-2-1... The slave releases his man filth onto the floor and he is demanded to lick up every last drop of his own disgusting white goo.
Model:
Michelle Lacy, Natalya Sadici
Studio:
Clubdom.com
Info:
File Name : s645michellelacynatalyasadicipov02.mp4
File Size : 511.4 MB
Resolution : 1920x1080
Duration : 00:05:56

Download K2S VIDEO:
Keep2Share Video: s645michellelacynatalyasadicipov02.mp4 (https://k2s.cc/file/aacc4f3e81554)

Clit
02-04-2025, 03:21 AM
Clubdom.com- Marina Angel Strapon Humiliation
https://img34.imagetwist.com/th/67055/lbiglr2327z1.jpg (https://imagetwist.com/lbiglr2327z1/ZQDJlZ.jpg)
https://img119.imagetwist.com/th/67055/5chsfxmk1lkc.jpg (https://imagetwist.com/5chsfxmk1lkc/ZCbaebPz.jpg)

Description:
ClubDom, In Our World Women Rule. Mistress Cheyenne has got her slave by the balls and isn_t going to let him off easy It_s ball busting time In Our World ..
Model:
Marina Angel, Molly Jane
Studio:
Clubdom.com
Info:
File Name : s593marinaangelstrapon2.mp4
File Size : 466.29 MB
Resolution : 1920x1080
Duration : 00:05:25

Download K2S VIDEO:
Keep2Share Video: s593marinaangelstrapon2.mp4 (https://k2s.cc/file/aaeeee6995d62)

Clit
02-04-2025, 03:28 AM
Clubdom.com- Severe Paddling is Your Punishment
https://img34.imagetwist.com/th/67054/kfwxgoqk4agj.jpg (https://imagetwist.com/kfwxgoqk4agj/EkzGsHQR.jpg)
https://img401.imagetwist.com/th/67054/soajqks7hgjg.jpg (https://imagetwist.com/soajqks7hgjg/JgffpsP.jpg)

Description:
Goddess Michelle Lacy as instructed her residence slave Bart to sweep and clean the dungeon. After closer inspection she sees that he has done a horrible job and he must be punished. She leads the bitch in on a leash and then bends him right over her lap. Spanking his bare ass with her hand explaining to him this is the only way you will learn. Feeling this is not severe enough she instructs the slave to grab his ankles. Goddess pulls out the paddle continuing with multiple strikes across the bitches red ass. The leaving him to finish his duties of cleaning the dungeon. She mentions to slave Alex, why can_t they all be more just like you. Alex asks for permission to speak. Goddess says yes Alex go ahead Alex says I believe it was actually my turn to clean the dungeon. Michelle laughs and says oh well, no problem. As slave Bart looks back humiliated and embarrassed Michelle yells keep sweeping bitch
Model:
Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s587michellelacybriannaspanking.mp4
File Size : 450.94 MB
Resolution : 1920x1080
Duration : 00:05:15

Download K2S VIDEO:
Keep2Share Video: s587michellelacybriannaspanking.mp4 (https://k2s.cc/file/69622f7bb66d1)

Clit
02-04-2025, 03:43 AM
Clubdom.com- Daisy Ducati & Raven Bay Small Dick
https://img119.imagetwist.com/th/67117/bp7g286aega0.jpg (https://imagetwist.com/bp7g286aega0/kXdCYnX.jpg)
https://img166.imagetwist.com/th/67117/raon3c2q55v6.jpg (https://imagetwist.com/raon3c2q55v6/btZLpf.jpg)

Description:
Goddess Daisy Ducati and Raven Bay are giving you jerk off instruction today, First thing they want you to do is get a ruler, Then measure that tiny pathetic cock, What only 2 inches, Thats what we thought loser, now take some icy hot and rub it on that tiny excuse of a dick and keep rubbing it until it starts to burn, That_s right slut now that your little dicklet feels like it_s on fire we want you to smack those tiny little pebbles you like to call balls, take the ruler and beat those little suckers till they are bright red and start to swell, Then i am going to count to three and you better shoot your pathetic load
Model:
Daisy Ducati, Raven Bay
Studio:
Clubdom.com
Info:
File Name : s809daistyducatiravenbaysmalldickpov.mp4
File Size : 686.09 MB
Resolution : 1920x1080
Duration : 00:07:52

Download K2S VIDEO:
Keep2Share Video: s809daistyducatiravenbaysmalldickpov.mp4 (https://k2s.cc/file/2cd27f569262f)

Clit
02-04-2025, 04:03 AM
Clubdom.com- Cherry Morgan & Alina StrapOn Fuck
https://img69.imagetwist.com/th/67070/euow1gbkfo4r.jpg (https://imagetwist.com/euow1gbkfo4r/LQCAthK.jpg)
https://img166.imagetwist.com/th/67070/e9amjqhfwokk.jpg (https://imagetwist.com/e9amjqhfwokk/KFWOnMe.jpg)

Description:
Goddess Cherry Morgan and Mistress Alina Long decide its time to pound some man pussy. They instruct the slaves to wrap their lips around the big black cocks and get them tubed up for the anal stretching of their life. The male bitches slobber, gulp and gag on the huge dicks. Then are bent and fucked hard. Begging for every inch the slaves are the flipped over into piledriver and rammed hard and deep squealing and begging for mercy as the ladies make them scream I am an cock whore please fuck me harder.
Model:
Alina Long, Cherry Morgan
Studio:
Clubdom.com
Info:
File Name : s633cherrymorganalinalongstrapon.mp4
File Size : 503.61 MB
Resolution : 1920x1080
Duration : 00:05:52

Download K2S VIDEO:
Keep2Share Video: s633cherrymorganalinalongstrapon.mp4 (https://k2s.cc/file/9465b94346c92)

Clit
02-04-2025, 04:12 AM
Clubdom.com- Rilynn & Roxi StrapOn Fucking
https://img202.imagetwist.com/th/67086/1w6bci7lrk9y.jpg (https://imagetwist.com/1w6bci7lrk9y/YdNBjiL.jpg)
https://img166.imagetwist.com/th/67087/zid8pb7yw5tn.jpg (https://imagetwist.com/zid8pb7yw5tn/kgflJlW.jpg)

Description:
These Goddess_s know all you dream of is big black cock stretching out your pathetic man cunt you fantasize about Goddess Rilynn Rae and Mistress Roxii Blair pounding your little pussy owning you completely, dominating, you and then allowing you to stroke that little 2 inch slut stick only to lick up your own filth and get back in your cage.
Model:
Rilynn Rae, Roxii Blair
Studio:
Clubdom.com
Info:
File Name : s6812-2rilynnraeroxiiblairstrapon.mp4
File Size : 575.49 MB
Resolution : 1920x1080
Duration : 00:06:39

Download K2S VIDEO:
Keep2Share Video: s6812-2rilynnraeroxiiblairstrapon.mp4 (https://k2s.cc/file/55ec77623cf8f)

Clit
02-04-2025, 04:21 AM
Clubdom.com- Dava Foxx & Kylie Chindo
https://img34.imagetwist.com/th/67057/x968462zm0cz.jpg (https://imagetwist.com/x968462zm0cz/BptiQKKZ.jpg)
https://s10.imagetwist.com/th/67057/j2f8rubpso2y.jpg (https://imagetwist.com/j2f8rubpso2y/qtenvmU.jpg)

Description:
Goddess Dava Foxx and Mistress Kylie Rogue tell their bitch it_s time to make his mistress cum. They strap a dildo gag to the slaves face and tell him he has exactly 3 minutes to make each of them get off. Of course one stipulation is that he will be brutally caned by the other while he fucks. Goddess Dava tells the bitch remember this is your sole purpose in life, it is the price of servitude.
Model:
Dava Foxx, Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : s619davafoxxkylieroguechidocaning.mp4
File Size : 612.12 MB
Resolution : 1920x1080
Duration : 00:07:04

Download K2S VIDEO:
Keep2Share Video: s619davafoxxkylieroguechidocaning.mp4 (https://k2s.cc/file/cf2eac7582983)

Clit
02-04-2025, 04:28 AM
Clubdom.com- Jean Bardot & Kylie Femdom Sex Part 2
https://img202.imagetwist.com/th/67053/2gcf1n7jd7p6.jpg (https://imagetwist.com/2gcf1n7jd7p6/rFHqyF.jpg)
https://s10.imagetwist.com/th/67053/y41fob6b639r.jpg (https://imagetwist.com/y41fob6b639r/bPQHSiuB.jpg)

Description:
Mistresses Jean Bardot and Kylie Rouge have hired Lew and Alex, two repairmen to do some odd jobs around the property today. Imagine the shock to the two Doms when one of the repairmen turns out to be a canceling male chauvinist pig. Despite the protests of his partner Alex, Lew can_t shut his mouth and stop letting his male arrogance get him deeper and deeper in trouble. Even worse, after being given direct orders from Miss Bardot not to enter her private dungeon, the brazen idiot marches right in at first opportunity, considering her warnings a joke. Little did these two repairmen know that the joke would be on them. We next find our repairmen in the dungeon, Alex in a kennel and loudmouth Lew strapped to a milking bench. Goddess Jean Bardot is furious and decides to remove some of Lews testosterone by milking his overactive balls. Both Mistress Kylie and Goddess Jean take turns roughing pulling and milking Lews pig stick as he both moans on pleasure and cries in agony. The Goddess_s to not let up for a second, taunting and tormenting the loudmouth caveman as they pull his cum out of his cock and then force him to eat it. Not satisfied, Goddess Jean unleashes fury of kicks to the repairman_s_ balls, leaving him howling like a wounded as the Goddess_s move on to repairman Alex. Having been the well behaved one, the Goddesses allow Alex a chance to earn his freedom. If the stud can hold his load and fuck Mistress Kylie and make her cum in under 3 minutes he will be allowed to go free. To drive this point home, Mistress Jean demands Alex deeply inhale the scent of Mistress Kylie womanhood. Driven to please his Masters, Alex fucks the Miss Kylie with all the passion he can muster, finally making her quiver in climax. As Alex withdraws, Goddess Jean realizes that Alex came in his condom as well Furious, the Doms teabag Alex_s slutty mouth with the filled scumbag, then humiliate him by dumping his filth out on his face and in his mouth. Mistress Jean promises he will be punished for an unauthorized orgasm. We return to find both Goddesses amusing themselves punishing Alex by shocking him with a cattle prod. Alex jumps and flails wildly, not knowing where the next jolt of electricity will come from. Both Ladies laugh and laugh at the spectical before them, noticing that the repairman is paying close attention to their boots. Taking mercy on the sad little slut, Mistress Kylie Rouge and Jean Bardot allow the worm to lock and kiss their boots. As the boots become shiny through worship, both Dommes notice that Alex is quite turned on by worshipping their boots, and demand he become a little boot bumper. Alex eagerly humps away like a bunny, slamming his hips and cock into Mistress Kylie boots until he can_t hold back and explodes all over them. Amused, Goddess Jean demands Alex link up his filth. Mistress Kylie mentions how turned on she is, and Goddess Jean remembers that they still have a loudmouth slave to punish. Nothing makes Mistress Kylie cum like the pain and agony of a slave, and Goddess Jean delivers in spades on the rude and arrogant hide of Lew. A brutal caning leaves the loudmouths ass covered in multicolored welts as tears roll down the pigs face and his screams fill the air. all this pain and suffering has Miss Kylie on the verge of orgasm, so Goddess Jean switches to a whip to amp up the pain even more. Spine chilling screams echo throughout the club do estate as Lew begs and pleads for mercy while Miss Kyle reaches orgasm due to his pain. To finally drive home the point that men should respect women both Doms Don their 10 inch strap on cocks and destroy both repairman asses. Both are flipped upside down and InsideOut but neither can escape nor gain any mercy from the monster cocks if Mistress Jean and Kylie. Once completely Fucked, both boys are ordered to clean thier asses off the cocks that just pounded their formally virgin holes. Finally satisfied Goddess Jean tells loudmouth Lew to scram, and he quickly runs for his life off property. However, the cure and respectful Alex is offered a spot in the club do stable.
Model:
Jean Bardot, Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : s569_jean_bardot_kylie_rogue_part2.mp4
File Size : 632.46 MB
Resolution : 1920x1080
Duration : 00:07:20

Download K2S VIDEO:
Keep2Share Video: s569_jean_bardot_kylie_rogue_part2.mp4 (https://k2s.cc/file/a3b6d6028ab31)

Clit
02-04-2025, 05:29 AM
Clubdom.com- Kendra James & Lydia StrapOn POV
https://img119.imagetwist.com/th/67090/s7s35ubpxnkj.jpg (https://imagetwist.com/s7s35ubpxnkj/NLpcyJPs.jpg)
https://img34.imagetwist.com/th/67090/p6qd4yz8gynf.jpg (https://imagetwist.com/p6qd4yz8gynf/DntDLw.jpg)

Description:
Mistress Kendra James and Goddess Lydia Supremacy tower over you with their 12 black strap-on cocks in your face with you on your knees where you belong. Now bitch, show us how much you want are cocks. They force you to deep throat Goddess Lydia_s 12 strap-on as Mistress Kendra shoves hers right up that tight man pussy of yours. As you are being face fucked and anally destroyed they let you jerk that 2 pathetic dick of yours. Mistress Kendra decides to let your little bitch ass release your filth for them as they laugh and humiliate you.
Model:
Kendra James, Lydia Supremacy
Studio:
Clubdom.com
Info:
File Name : s693kendralydiastraponpov.mp4
File Size : 481.01 MB
Resolution : 1920x1080
Duration : 00:05:38

Download K2S VIDEO:
Keep2Share Video: s693kendralydiastraponpov.mp4 (https://k2s.cc/file/48fbd34ef1611)

Clit
02-04-2025, 05:30 AM
Clubdom.com- Michelle Lacy & Natalya StrapOn
https://img119.imagetwist.com/th/67069/qocgd7mg13ww.jpg (https://imagetwist.com/qocgd7mg13ww/aheHWFHZ.jpg)
https://s10.imagetwist.com/th/67070/nqq6zv8l0gv9.jpg (https://imagetwist.com/nqq6zv8l0gv9/YGqGYMQW.jpg)

Description:
Mistress Michelle Lacy and Mistress Natalya Sadici want you on your knees where you belong as they stroke there 12 cocks right above your head. Mistress Michelle and Mistress Natalya dont think you can even handle their cocks. You are so pathetic and worthless to us, but dont worry we will let you play with that tiny 1 thing of yours. Now when we tell you to release your filth u better hope its somewhat decent because youre going to use it to lube up that man pussy of yours unless you want us to stretch out that hole dry. Mistress Michelle and Natalya want you to stroke it faster and faster. Are you ready you worthless slave? Five, four, three, two, one. Is that all you have for your mistresses? Well it looks like dry stretching it is. Now bend over HAHAHAHAHAHA
Model:
Michelle Lacy, Natalya Sadici
Studio:
Clubdom.com
Info:
File Name : s646michellelacynatalyasadici.mp4
File Size : 540.71 MB
Resolution : 1920x1080
Duration : 00:06:17

Download K2S VIDEO:
Keep2Share Video: s646michellelacynatalyasadici.mp4 (https://k2s.cc/file/7e08f650cb8b3)

Clit
02-04-2025, 05:56 AM
Clubdom.com- Stroke Your Slut Stick POV
https://img401.imagetwist.com/th/67079/fek0plwnbitd.jpg (https://imagetwist.com/fek0plwnbitd/legbQkI.jpg)
https://img202.imagetwist.com/th/67079/9z9ajmbqwsq1.jpg (https://imagetwist.com/9z9ajmbqwsq1/UeNVMIo.jpg)

Description:
Mistress Jamie Valentine Knows you love looking at her big round tits and stroking your pathetic slut stick. You have a 2 in tiny dicklett and would give anything just to be near Mistress Jamie_s shiny black boots and hot sexy curvy body. So go ahead and use your thumb and index finger and stroke every last drop of filth into a teaspoon and slurp up every last drop.
Model:
Jamie Valentine
Studio:
Clubdom.com
Info:
File Name : s660jamievalentinepov.mp4
File Size : 626.65 MB
Resolution : 1920x1080
Duration : 00:07:12

Download K2S VIDEO:
Keep2Share Video: s660jamievalentinepov.mp4 (https://k2s.cc/file/062c107c7cd77)

Clit
02-04-2025, 06:13 AM
Clubdom.com- Lydia & Kylie Rogue Stable StrapOn
https://img202.imagetwist.com/th/67117/i8modz025tx1.jpg (https://imagetwist.com/i8modz025tx1/aAVoLd.jpg)
https://img401.imagetwist.com/th/67118/v8l5apagcl53.jpg (https://imagetwist.com/v8l5apagcl53/VMvIDlSK.jpg)

Description:
Lydia Supremacy likes a good sloppy blowjob and you don_t have any choice in the matter, Slave. She is going to be pinning your slut hole from behind hard enough for you to feel it in your throat, so get all that filthy spit on it while you still can. Kylie Rogue makes sure to ram a couple screams out of him before Lydia is tagged to annihilate the bitches man-pussy.
Model:
Kylie Rogue, Lydia Supremacy
Studio:
Clubdom.com
Info:
File Name : s844lydiasupremacykylieroguestablestrapon.mp4
File Size : 484.6 MB
Resolution : 1920x1080
Duration : 00:05:41

Download K2S VIDEO:
Keep2Share Video: s844lydiasupremacykylieroguestablestrapon.mp4 (https://k2s.cc/file/8fd8985e0c607)

Clit
02-04-2025, 02:07 PM
Clubdom.com- Nikki Brooks Chindo Dildo Pussy Pleasure
https://img34.imagetwist.com/th/67156/ylrz36n8q6dk.jpg (https://imagetwist.com/ylrz36n8q6dk/dXKiTvjB.jpg)
https://img166.imagetwist.com/th/67156/ivaqklu7u1mf.jpg (https://imagetwist.com/ivaqklu7u1mf/UsIwQB.jpg)

Description:
ClubDom, In Our World Women Rule. Mistress Cheyenne has got her slave by the balls and isn_t going to let him off easy It_s ball busting time In Our World ..
Model:
Nikki Brooks
Studio:
Clubdom.com
Info:
File Name : cd_s1071_nikkibrooks_chindo.mp4
File Size : 656.03 MB
Resolution : 1920x1080
Duration : 00:07:33

Download K2S VIDEO:
Keep2Share Video: cd_s1071_nikkibrooks_chindo.mp4 (https://k2s.cc/file/bed653d5f54c4)

Clit
02-04-2025, 02:15 PM
Clubdom.com- Lydia Supremacy Strapon POV
https://s10.imagetwist.com/th/67159/2fobxwldd6at.jpg (https://imagetwist.com/2fobxwldd6at/iIvnLNlB.jpg)
https://img166.imagetwist.com/th/67159/d0hhmgb6cz3e.jpg (https://imagetwist.com/d0hhmgb6cz3e/GaZoGhRL.jpg)

Description:
Goddess Lydia Supremacy wants to make you her pathetic little bitch. She tells you how she_s going to skull fuck you with her big black cock. Goddess Lydia stands in front of you stroking her cock while telling you what she_s going to do to your pathetic slut hole, as she gives you instructions on how to please her.
Model:
Dahlia Rain, Lydia Supremacy
Studio:
Clubdom.com
Info:
File Name : cd_s1091_dahliarain_lydiasupremacy_lydiastrappov.m p4
File Size : 479.45 MB
Resolution : 1920x1080
Duration : 00:05:35

Download K2S VIDEO:
Keep2Share Video: cd_s1091_dahliarain_lydiasupremacy_lydiastrappov.m p4 (https://k2s.cc/file/218a35a6d95c4)

Clit
02-04-2025, 02:48 PM
Clubdom.com- Caned-Meat
https://img119.imagetwist.com/th/67149/o95z1wv3agub.jpg (https://imagetwist.com/o95z1wv3agub/zxLIBCg.jpg)
https://img69.imagetwist.com/th/67149/4sdc0g5wpemc.jpg (https://imagetwist.com/4sdc0g5wpemc/unOXRZ.jpg)

Description:
Goddess Amadahy and Queen Qandisa roll their slave into the room. Bound and trapped in a cock stockade and at their mercy, he hopes that they will go easy on him....but with his cock and ass exposed and these two wicked women wielding canes, it is very unlikely The women cane him mercilessly, and love how he suffers and squeals in pain. His pain is their pleasure.
Model:
Goddess Amadahy, Queen Qandisa
Studio:
Clubdom.com
Info:
File Name : cd_s1040_qandisa_amadahy_caning.mp4
File Size : 764.71 MB
Resolution : 1920x1080
Duration : 00:08:49

Download K2S VIDEO:
Keep2Share Video: cd_s1040_qandisa_amadahy_caning.mp4 (https://k2s.cc/file/be6ca575928f8)

Clit
02-04-2025, 02:50 PM
Clubdom.com- Lady Cheyenne Whips a Slave_s Backside
https://img69.imagetwist.com/th/67140/lu8a31iokogw.jpg (https://imagetwist.com/lu8a31iokogw/rCXJWux.jpg)
https://img401.imagetwist.com/th/67140/6hufggyhuac0.jpg (https://imagetwist.com/6hufggyhuac0/MLMhlf.jpg)

Description:
Lady Cheyenne whips a slave_s backside..
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : Movie298.wmv
File Size : 11.65 MB
Resolution : 320x240
Duration : 00:03:08

Download K2S VIDEO:
Keep2Share Video: Movie298.wmv (https://k2s.cc/file/bb6015cf594f5)

Clit
02-04-2025, 02:56 PM
Clubdom.com- Dahila StrapOn Fucks Man-Pussy
https://img69.imagetwist.com/th/67159/4iobmh0b5nst.jpg (https://imagetwist.com/4iobmh0b5nst/HxygLKGp.jpg)
https://img401.imagetwist.com/th/67159/yugbkjmperjy.jpg (https://imagetwist.com/yugbkjmperjy/RVfkMW.jpg)

Description:
Goddess Dahlia Rain wants to stretch out her new slave_s man pussy with her big black cock. She forces her slave_s mouth over her huge strap on cock to lube it up before she starts pegging his slut hole. After his allotted time is up, Goddess Dahlia takes her position behind her slave and fills his tight man pussy with her black dong to make him her personal slut.
Model:
Dahlia Rain
Studio:
Clubdom.com
Info:
File Name : cd_s1090_3-3_dahliarain_lydiasupremacy_strapon.mp4
File Size : 527.13 MB
Resolution : 1920x1080
Duration : 00:06:07

Download K2S VIDEO:
Keep2Share Video: cd_s1090_3-3_dahliarain_lydiasupremacy_strapon.mp4 (https://k2s.cc/file/9bc939caa91ae)

Clit
02-04-2025, 03:15 PM
Clubdom.com- Fur Goddesses Sunbathing Ass Worship
https://s10.imagetwist.com/th/67129/ntq6da4qlxu9.jpg (https://imagetwist.com/ntq6da4qlxu9/tnMCAn.jpg)
https://img401.imagetwist.com/th/67129/n7fjw72jzl13.jpg (https://imagetwist.com/n7fjw72jzl13/jEjnKWsY.jpg)

Description:
After having their feet worshipped, Mistresses Natalia and Paris order their slave to worship their asses. When they have had enough, Natalia shoves the slave into the pool and orders him to stay there until they allow him to get out.
Model:
Natalia Starr, Paris Knight
Studio:
Clubdom.com
Info:
File Name : s907nataliastarrparisknightmichellelacyassworship. mp4
File Size : 478.59 MB
Resolution : 1920x1080
Duration : 00:05:29

Download K2S VIDEO:
Keep2Share Video: s907nataliastarrparisknightmichellelacyassworship. mp4 (https://k2s.cc/file/1ae6af2137607)

Clit
02-04-2025, 03:16 PM
Clubdom.com- Jamie Valentine- Ball Abuse for New Slave
https://img69.imagetwist.com/th/67143/z4aq8nw4v4hz.jpg (https://imagetwist.com/z4aq8nw4v4hz/pgfrYK.jpg)
https://img34.imagetwist.com/th/67143/7niykzaiqtri.jpg (https://imagetwist.com/7niykzaiqtri/oRTzdE.jpg)

Description:
A new slave has arrived to Club Dom and Jamie Valentine cannot wait to sink her claws into him. She leads him out of the cage and he stares up at his new Goddess as she says Lets have some fun with youHe is already in a humbler, so she decides to keep it on him and torment his balls. She uses a whip, and her hare hands and sharp nails, to inflict pain on the helpless and terrified new-comer. She shows him a taste of what it is going to be like here at Club Dom while she throws a horse hair whip over his sensitive and exposed balls.
Model:
Jamie Valentine
Studio:
Clubdom.com
Info:
File Name : cd_s985_jamievalentine_introcbt.mp4
File Size : 564.88 MB
Resolution : 1920x1080
Duration : 00:06:36

Download K2S VIDEO:
Keep2Share Video: cd_s985_jamievalentine_introcbt.mp4 (https://k2s.cc/file/8767493e0dc95)

Clit
02-04-2025, 03:18 PM
Clubdom.com- Amadahy_s Ball Stretch and Burn
https://img401.imagetwist.com/th/67149/t6vc7zt1hvzr.jpg (https://imagetwist.com/t6vc7zt1hvzr/VRtAbOyR.jpg)
https://img69.imagetwist.com/th/67149/zu1maga4c92d.jpg (https://imagetwist.com/zu1maga4c92d/mjeLoIuj.jpg)

Description:
Amadahy has found her slave still strung up outside from the night before. She was sure another Mistress had put him away in the cage, but here he was, all night, standing and tethered by the whipping post. She lights up a cigarette and looks him over. She demands that he open up his trash receptacle of a mouth and eat her ashes and thank her. He does as he is told. She spits at him, and looks him over some more. Today is the day that she begins his ball stretching. More smoke is blown in his face and ashes eaten until she decides to grab some heavy weights to tether to his balls. 3 more months of ball stretching she says as she measures how far she expects to stretch him. She doesn_t stop there.
Model:
Goddess Amadahy
Studio:
Clubdom.com
Info:
File Name : cd_s1038_qandisa_amadahy_ballburn.mp4
File Size : 603.17 MB
Resolution : 1920x1080
Duration : 00:07:01

Download K2S VIDEO:
Keep2Share Video: cd_s1038_qandisa_amadahy_ballburn.mp4 (https://k2s.cc/file/0856dca4e2933)

Clit
02-04-2025, 03:28 PM
Clubdom.com- Arena Rome Ball Busting
https://img69.imagetwist.com/th/67163/hkfyrgfr89cq.jpg (https://imagetwist.com/hkfyrgfr89cq/bUajHft.jpg)
https://s10.imagetwist.com/th/67163/1533biq22dcv.jpg (https://imagetwist.com/1533biq22dcv/nixECh.jpg)

Description:
Queen Arena Rome drags her slave into her dungeon and forces his legs apart. She then gets a running start to kick him in his useless slut sacks. Queen Arena drags her slave around and uses her hands and feet to bust his fucking balls.
Model:
Arena Rome
Studio:
Clubdom.com
Info:
File Name : cd_s1110_1-5_arenarome_ballbust.mp4
File Size : 583.24 MB
Resolution : 1920x1080
Duration : 00:06:46

Download K2S VIDEO:
Keep2Share Video: cd_s1110_1-5_arenarome_ballbust.mp4 (https://k2s.cc/file/3505233a436a1)

Clit
02-04-2025, 03:44 PM
Clubdom.com- Doormat for Queen
https://s10.imagetwist.com/th/67129/n7mqsc52iqum.jpg (https://imagetwist.com/n7mqsc52iqum/iWMUQm.jpg)
https://img69.imagetwist.com/th/67129/wzjlea3cx3oe.jpg (https://imagetwist.com/wzjlea3cx3oe/klaaxR.jpg)

Description:
My slave has pissed me off and so I inform him that he does not get to attend the party tonight with me. Instead he will serve as my door mat. Dressed in my leopard print dress and gorgeous black fur coat, I make him clean the bottoms of my red pumps, and just for good measure, I make him deep throat the heels. I dig my heels into his nipples and kick him in the balls, letting him know his place beneath my feet. Then I remove one of my shoes and make him gag on my feet and worship my toes. This loser slave will learn not to piss me off.
Model:
Alina Long
Studio:
Clubdom.com
Info:
File Name : doormat_of_fur_queencd.mp4
File Size : 59.47 MB
Resolution : 640x360
Duration : 00:06:14

Download K2S VIDEO:
Keep2Share Video: doormat_of_fur_queencd.mp4 (https://k2s.cc/file/1ad921fb10a46)

Clit
02-04-2025, 03:44 PM
Clubdom.com- Your Last Orgasm Ever POV
https://img202.imagetwist.com/th/67129/euq6pbq6lp00.jpg (https://imagetwist.com/euq6pbq6lp00/rtzDLNOf.jpg)
https://img202.imagetwist.com/th/67129/t6erb6559s32.jpg (https://imagetwist.com/t6erb6559s32/RdIgXvJ.jpg)

Description:
Once again your small dick has ruined your life. You put so much work into serving Miss Lydia, and she was even considering adding you to her harem of sex slaves - but that was before she saw how tiny and pathetic your cock was. Now, not only will you never have sex with Lydia, she has decided you should never have sex again - period
Lydia does show some mercy, though, and allows you one last chance to stroke your tiny cock. She even lets you use her divine spit as lube. But make no mistake, once she finishes her countdown, the jaws of her castration device will clamp down on your cock, forever destroying your ability to get an erection. But like Lydia says, small dicked men should never be allowed to breed anyway. So enjoy your one last chance to have an orgasm, because you will soon be watching your cock shrivel up and disappear.
Model:
Lydia Supremacy
Studio:
Clubdom.com
Info:
File Name : s895michellelacynatalyasadiciisobeldevillydiasupre macylydiapov.mp4
File Size : 481.45 MB
Resolution : 1920x1080
Duration : 00:05:36

Download K2S VIDEO:
Keep2Share Video: s895michellelacynatalyasadiciisobeldevillydiasupre macylydiapov.mp4 (https://k2s.cc/file/829674740ee4f)

Clit
02-04-2025, 04:27 PM
Clubdom.com- Goddess Cheyenne & Jean Bardot StrapOn
https://s10.imagetwist.com/th/67166/a2dr7f9p78cb.jpg (https://imagetwist.com/a2dr7f9p78cb/YNVAazP.jpg)
https://img166.imagetwist.com/th/67166/jpt6syrmp9de.jpg (https://imagetwist.com/jpt6syrmp9de/DcbxUy.jpg)

Description:
Goddess Cheyenne and Mistress Jean Bardot demand that their slave comes over and worship their big black cocks. They force their slave to suck on each of their strap on cocks. Goddess Cheyenne then bends him over to ram her cock all the way in his tight man pussy while he sucks Mistress Jean Bardot_s black cock.
Model:
Goddess Cheyenne, Jean Bardot
Studio:
Clubdom.com
Info:
File Name : cd_s1101_goddesscheyenne_mistressjeanbardot_strapo n.mp4
File Size : 459.11 MB
Resolution : 1920x1080
Duration : 00:05:18

Download K2S VIDEO:
Keep2Share Video: cd_s1101_goddesscheyenne_mistressjeanbardot_strapo n.mp4 (https://k2s.cc/file/ddf3056e98502)

Clit
02-04-2025, 04:43 PM
Clubdom.com- Lydia Supremacy- Mistress Lydia_s Anal Puppet
https://img166.imagetwist.com/th/67129/wcdylfjej3y8.jpg (https://imagetwist.com/wcdylfjej3y8/KnyDEQGq.jpg)
https://s10.imagetwist.com/th/67129/9tyj7cmyek1e.jpg (https://imagetwist.com/9tyj7cmyek1e/htYmFYdT.jpg)

Description:
Mistress Lydia has big plans for you as her future anal puppet. She wants to stretch your ass out until she can punch her entire arm into your asshole and not even feel any resistance Lydia loves making men into her anal whores, so start now with two fingers up your ass - then three - then....
Of course, Lydia plans on other ways of violating your ass as well. Maybe she will spit in it - or pee in it - or have her make slaves jerk off over it and fill it with cum? Lydia notices your little cock getting hard as she details how she might abuse you and orders you to go ahead and jerk your tiny dick on her command. But just know that once you do, your ass will truly belong to her in more ways than one.
Model:
Lydia Supremacy
Studio:
Clubdom.com
Info:
File Name : s896michellenatalyasobellydialydiapov2.mp4
File Size : 524.57 MB
Resolution : 1920x1080
Duration : 00:06:12

Download K2S VIDEO:
Keep2Share Video: s896michellenatalyasobellydialydiapov2.mp4 (https://k2s.cc/file/d19ae1ecd5bb2)

Clit
02-04-2025, 05:05 PM
Clubdom.com- Paris Knight- Face-Sitting Box
https://img166.imagetwist.com/th/67141/os1gj9od6o2k.jpg (https://imagetwist.com/os1gj9od6o2k/yROLlDOl.jpg)
https://img202.imagetwist.com/th/67141/8axp8xxtdjkh.jpg (https://imagetwist.com/8axp8xxtdjkh/rOhZKhK.jpg)

Description:
Paris has her oral pleasure slave restrained inside the face-sitting box. She teases her slave at first, showing him her sweet pussy and ass. Then she sits on his face, only allowing him to lick her gorgeous ass, while she plays with her pussy. He cannot reach her pussy as he is just stuck in this box.
Model:
Paris Knight
Studio:
Clubdom.com
Info:
File Name : cd_s975_jeanbardot_parisknight_smotherbox.mp4
File Size : 866.08 MB
Resolution : 1920x1080
Duration : 00:10:02

Download K2S VIDEO:
Keep2Share Video: cd_s975_jeanbardot_parisknight_smotherbox.mp4 (https://k2s.cc/file/9115174bada14)

Clit
02-04-2025, 05:20 PM
Clubdom.com- Nadia & Goddess Valora_s Caning Plaything
https://s10.imagetwist.com/th/67158/i4bnwocvs4lo.jpg (https://imagetwist.com/i4bnwocvs4lo/tvOosDd.jpg)
https://img166.imagetwist.com/th/67158/8c5lm9acskug.jpg (https://imagetwist.com/8c5lm9acskug/dpElFX.jpg)

Description:
Goddess Valora and Nadia White are in search of a plaything and pull one of their slaves out of his cage. They make him kiss their canes before they bend him over and let their canes kiss his pasty ass. The Goddesses keep caning his pathetic ass and make him count how many times he gets caned.
Model:
Goddess Valora, Nadia White
Studio:
Clubdom.com
Info:
File Name : cd_s1077_nadiawhite_goddessvalora_caning.mp4
File Size : 659.88 MB
Resolution : 1920x1080
Duration : 00:07:39

Download K2S VIDEO:
Keep2Share Video: cd_s1077_nadiawhite_goddessvalora_caning.mp4 (https://k2s.cc/file/d394652b39edc)

Clit
02-04-2025, 05:24 PM
Clubdom.com- Milked Slut
https://img166.imagetwist.com/th/67167/b3n1sfy2h9ok.jpg (https://imagetwist.com/b3n1sfy2h9ok/lKIEQgbN.jpg)
https://s10.imagetwist.com/th/67168/uks1s6ekxsgb.jpg (https://imagetwist.com/uks1s6ekxsgb/vlGDPXZG.jpg)

Description:
GODDESS, Amadahy and Cheyenne Jewel milk the pathetic slut filling the glass full of his man filth. Slut knowing it is his only nourishment for the next 30 days, drinks up every last drop and begs for more.
Model:
Cheyenne Jewel, Goddess Amadahy
Studio:
Clubdom.com
Info:
File Name : cd_s509_cheyenne_jewel_amadahy_milking.mp4
File Size : 536.28 MB
Resolution : 1920x1080
Duration : 00:06:12

Download K2S VIDEO:
Keep2Share Video: cd_s509_cheyenne_jewel_amadahy_milking.mp4 (https://k2s.cc/file/55a7f3d6f3e57)

Clit
02-04-2025, 05:26 PM
Clubdom.com- Rikki Rumor & Jade StrapOn Fucking
https://img166.imagetwist.com/th/67130/hlsjvo6cvntm.jpg (https://imagetwist.com/hlsjvo6cvntm/_zUF.jpg)
https://img166.imagetwist.com/th/67130/c1cvvkf7gfyv.jpg (https://imagetwist.com/c1cvvkf7gfyv/nBLFnrxB.jpg)

Description:
ClubDom, In Our World Women Rule. Mistress Cheyenne has got her slave by the balls and isn_t going to let him off easy It_s ball busting time In Our World ..
Model:
Jade Jantzen, Rikki Rumor
Studio:
Clubdom.com
Info:
File Name : s934rikkirumorjadejantzenstrrapon.mp4
File Size : 66.94 MB
Resolution : 640x360
Duration : 00:07:06

Download K2S VIDEO:
Keep2Share Video: s934rikkirumorjadejantzenstrrapon.mp4 (https://k2s.cc/file/9e1ae46880694)

Clit
02-04-2025, 05:28 PM
Clubdom.com- Michelle Controls and Owns your Manhood
https://img69.imagetwist.com/th/67147/ffvmahrrpdjv.jpg (https://imagetwist.com/ffvmahrrpdjv/EVdXAt.jpg)
https://img202.imagetwist.com/th/67147/fwc152ns5tir.jpg (https://imagetwist.com/fwc152ns5tir/YNBGTg.jpg)

Description:
Mistress Michelle Lacy knows that you SHOULD be locked up in a chastity device since you are so horny and disobedient and cannot stop touching yourself. But since you are unlocked, she is going to make you stroke your pathetic excuse for a cock for her, exactly the way she wants you to, while she teases you. She will tell you about how her slaves are trained and would never dream of touching their cock for fear of what she might do to them if they did without her permission, and that is going to eventually be what YOUR future holds since you just cannot control yourself. So show Michelle how you obey her now, and that she now controls your cock and owns your cock. Do as she says.
Model:
Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : cd_s1012_5-6_michellelacy_pov.mp4
File Size : 407.35 MB
Resolution : 1920x1080
Duration : 00:04:44

Download K2S VIDEO:
Keep2Share Video: cd_s1012_5-6_michellelacy_pov.mp4 (https://k2s.cc/file/76b6cbc04d51b)

Clit
02-04-2025, 05:40 PM
Clubdom.com- Inch by Inch
https://img166.imagetwist.com/th/67167/mf9ko48104hy.jpg (https://imagetwist.com/mf9ko48104hy/lfRHVYHV.jpg)
https://s10.imagetwist.com/th/67167/l77qwnky3qtg.jpg (https://imagetwist.com/l77qwnky3qtg/WyraSe.jpg)

Description:
Alexia Jordon has her bitch boy in a vulnerable position. His man pussy is exposed and ready for the taking. Alexia strokes her huge strap on cock and smiles. She is going to enjoy emasculating this slut, inch by inch. As Alexia slides her massive cock into the bitch_s man pussy, her smile becomes even more radiant. She thoroughly enjoys fucking this male slut, driving her cock deep into his bitch hole.
Model:
Alexia Jordon
Studio:
Clubdom.com
Info:
File Name : cd_s531_alexia_jordan_strap_on.mp4
File Size : 579.35 MB
Resolution : 1920x1080
Duration : 00:06:42

Download K2S VIDEO:
Keep2Share Video: cd_s531_alexia_jordan_strap_on.mp4 (https://k2s.cc/file/9c2cf34d1e27d)

Clit
02-04-2025, 05:48 PM
Clubdom.com- Seduced To Make Her Cum
https://img69.imagetwist.com/th/67164/x4rxti9lvb1b.jpg (https://imagetwist.com/x4rxti9lvb1b/GDEVzyv.jpg)
https://img166.imagetwist.com/th/67164/u6erspee1f4k.jpg (https://imagetwist.com/u6erspee1f4k/nNMNiHoP.jpg)

Description:
The slave is bound up with a dildo gag in his mouth. He can_t move much at all, not enough to run away. It_s time for him to learn his place here, and that is to exist fof the pleasure of the women. Mistress Esmi is a young and new Mistress at the compound but that doesn_t mean she doesn_t know how much power she has. She gets into the slave_s face and tells him that he has five minutes to pleasure her friend, Mistress Cadie, or else she is going to cane him until he is a mess. She seduces him into her pussy. Goddess Cadie instructs him on how to fuck her while Esmi shoves his pathetic face in and out. He doesn_t have much time left and has to make her cum. he is just a living, breathing tool for their pleasure now.
Model:
Cadie Coxx, Esmi Lee
Studio:
Clubdom.com
Info:
File Name : cd_s557_cadie_coxx_esmi_lee_chindo.mp4
File Size : 520.04 MB
Resolution : 1920x1080
Duration : 00:06:00

Download K2S VIDEO:
Keep2Share Video: cd_s557_cadie_coxx_esmi_lee_chindo.mp4 (https://k2s.cc/file/977a6d2e6dd10)

Clit
02-04-2025, 06:07 PM
Clubdom.com- Michelle_s Pleasure Slave 1- Oral Slave
https://img166.imagetwist.com/th/67146/s8kl4dtusuv8.jpg (https://imagetwist.com/s8kl4dtusuv8/gLrrEO.jpg)
https://s10.imagetwist.com/th/67146/jjq25ty266z5.jpg (https://imagetwist.com/jjq25ty266z5/HMHJstwc.jpg)

Description:
Mistress Michelle Lacy is away from the Club Dom estate, and enjoying herself alone with her slave. She has a bedroom turned into a dungeon which she will use to torment and train her slave in order to mold him into her most obedient pleasure puppet. She has her slave locked in a cage.
You are in for a real treat today slave. Today you get to worship my sweet pussy. The last slave didn_t do it for me and I have been pent-up ever since
She shoves her leather gloved finger across her wet pussy and makes him smell it. She then takes him out of the cage and shows him her pussy. She makes him worship her boots in order to get her pussy wet. She smashes a flogger on him and commands him to do it better. I said LICK she demands.
The boot slave continues to lick her boots, suck on the heel, cleans the bottoms and does as she demands. She then stops him and forces him to eat her pussy. She moans but he isn_t doing a very good job. She has to get herself off with her vibrator and decides she is going to make him suffer horribly for screwing up.
Model:
Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : cd_s1012_1-6_michellelacy_pussyworship.mp4
File Size : 578.73 MB
Resolution : 1920x1080
Duration : 00:06:43

Download K2S VIDEO:
Keep2Share Video: cd_s1012_1-6_michellelacy_pussyworship.mp4 (https://k2s.cc/file/f8fc5c103d1af)

Clit
02-04-2025, 06:17 PM
Clubdom.com- Goddess Jamie Valentine Whips Her Bitch
https://img166.imagetwist.com/th/67128/rk8fqamc0t33.jpg (https://imagetwist.com/rk8fqamc0t33/MFavzPv.jpg)
https://img119.imagetwist.com/th/67128/46bccga6172m.jpg (https://imagetwist.com/46bccga6172m/kIDmYLkk.jpg)

Description:
Goddess Jamie Valentine just got a new whip and decides it_s time to break it in on her slave, She makes him beg her for the whipping then gives him a sadistic brutal whipping completely shredding his back as he screams in agony, The more welted his back get the wetter Goddess Jamie_s Pussy gets she reminds him that this is his place in life to server her
Model:
Jamie Valentine
Studio:
Clubdom.com
Info:
File Name : s885jaimevalentinewhiping.mp4
File Size : 681.92 MB
Resolution : 1920x1080
Duration : 00:07:48

Download K2S VIDEO:
Keep2Share Video: s885jaimevalentinewhiping.mp4 (https://k2s.cc/file/16e4576b65122)

Clit
02-04-2025, 06:19 PM
Clubdom.com- Vicious Whipping Hot Summer
https://img202.imagetwist.com/th/67130/hyxxl0wcp1jh.jpg (https://imagetwist.com/hyxxl0wcp1jh/XJpUNA.jpg)
https://img34.imagetwist.com/th/67130/wlzegghwlwx3.jpg (https://imagetwist.com/wlzegghwlwx3/HZpubRg.jpg)

Description:
Bart is ordered to present his back, facing the large outdoor fireplace.It_s a hot day and the ladies have been swimming and dunking slaves all day. Looks like it_s time for some harsh whipping. Goddess Samanthastarts out hot and heavy with her quirt. Lashing Bart_s back really shows how muscular her back looks when in action. Soon Bart_s back is completely red and striped, but Mistress UV wants to get in on the action as she lashes Bart_s back just as hard. Looks like all that earlier whipping practice is paying off for the Goddesses.
Model:
Goddess Samantha
Studio:
Clubdom.com
Info:
File Name : cdviciouswhippinghotsummer.mp4
File Size : 159.36 MB
Resolution : 854x480
Duration : 00:07:04

Download K2S VIDEO:
Keep2Share Video: cdviciouswhippinghotsummer.mp4 (https://k2s.cc/file/d632fbb97f207)

Clit
02-04-2025, 06:22 PM
Clubdom.com- Fucked Owned and Used
https://img69.imagetwist.com/th/67140/p5rgb1kvej8y.jpg (https://imagetwist.com/p5rgb1kvej8y/mKisHdyp.jpg)
https://img401.imagetwist.com/th/67140/a7i3sznxbfu1.jpg (https://imagetwist.com/a7i3sznxbfu1/mhkcMB.jpg)

Description:
Paris Knight and Jean Bardot stuff the faces of their man slaves with their superior femdom cocks, ramming them deep down their drooling face-holes. The men have to take every inch down their throats as they stare up at the gorgeous latex-clad Goddesses who own them. The Mistresses decide to bend the two _ over their own cages and fuck them hard and deep in their pathetic asses until they feel totally humiliated and owned. It_s not enough that the women laugh and taunt them as they pound their holes but Paris decides to visit and join in on the fun and instructs slave 122 to lick her pussy while he gets fucked by Mistress Paris. The slave has no choice but to obey. He can taste her wet pussy and is overwhelmed by the power of all three women.
Model:
Jean Bardot, Paris Knight
Studio:
Clubdom.com
Info:
File Name : cd_s976_jeanbardot_parisknight_strapon.mp4
File Size : 724.44 MB
Resolution : 1920x1080
Duration : 00:08:23

Download K2S VIDEO:
Keep2Share Video: cd_s976_jeanbardot_parisknight_strapon.mp4 (https://k2s.cc/file/b1704979e6917)

Clit
02-04-2025, 06:52 PM
Clubdom.com- Isobel Devi & Veronica Snow StrapOn POV
https://img34.imagetwist.com/th/67148/3hjpvp4kyyvk.jpg (https://imagetwist.com/3hjpvp4kyyvk/XUqeWYTy.jpg)
https://img34.imagetwist.com/th/67149/l6ecb0ct650h.jpg (https://imagetwist.com/l6ecb0ct650h/suISVB.jpg)

Description:
You are in a deep sleep. Isobel Devi and Veronica Snow have infected your mind. You are now dreaming of them. The brainwashing has begun. You are on your knees begging for cock, helpless, growing weaker and weaker as the women taunt and control you. Before you even know what happened, there_s a cock inside your mouth, and you are sucking for your Mistresses.
Model:
Isobel Devi, Veronica Snow
Studio:
Clubdom.com
Info:
File Name : cd_s1036_isobeldevi_veronicasnow_straponpov.mp4
File Size : 560.39 MB
Resolution : 1920x1080
Duration : 00:06:29

Download K2S VIDEO:
Keep2Share Video: cd_s1036_isobeldevi_veronicasnow_straponpov.mp4 (https://k2s.cc/file/c2f943dd4a919)

Clit
02-04-2025, 07:18 PM
Clubdom.com- Harlow Harrison StrapOn
https://img69.imagetwist.com/th/67167/30rod9xt3ri1.jpg (https://imagetwist.com/30rod9xt3ri1/JbnkBhV.jpg)
https://s10.imagetwist.com/th/67167/e3pu18hl8a0x.jpg (https://imagetwist.com/e3pu18hl8a0x/cUupQuz.jpg)

Description:
Goddess Harlow Harrison drags her caged slave into her dungeon and forces him to suck her big black cock. Her slave loves having a hard strap on cock in his mouth, and she warns him to lube it up with his spit, because she_s gonna fucks his man pussy with it. Goddess Harlow bends him over and pushes the length of her hard cock deep into his tight man pussy.
Model:
Harlow Harrison
Studio:
Clubdom.com
Info:
File Name : cd_s1108_harlowharrison_strapon.mp4
File Size : 707.67 MB
Resolution : 1920x1080
Duration : 00:08:12

Download K2S VIDEO:
Keep2Share Video: cd_s1108_harlowharrison_strapon.mp4 (https://k2s.cc/file/2892d7390ea8c)

Clit
02-04-2025, 07:41 PM
Clubdom.com- Lexi & Kelly StrapOn Fucking
https://img119.imagetwist.com/th/67144/bcks286172uh.jpg (https://imagetwist.com/bcks286172uh/oKVejucz.jpg)
https://img166.imagetwist.com/th/67144/mf6i4d9gwnbo.jpg (https://imagetwist.com/mf6i4d9gwnbo/amfBvb.jpg)

Description:
ClubDom, In Our World Women Rule. Mistress Cheyenne has got her slave by the balls and isn_t going to let him off easy It_s ball busting time In Our World ..
Model:
Kelly Paige, Lexi Luna
Studio:
Clubdom.com
Info:
File Name : cd_s997_lexiluna_kellypaige_strapontoby.mp4
File Size : 575.73 MB
Resolution : 1920x1080
Duration : 00:06:39

Download K2S VIDEO:
Keep2Share Video: cd_s997_lexiluna_kellypaige_strapontoby.mp4 (https://k2s.cc/file/ab8dac7dc0773)

Clit
02-04-2025, 07:42 PM
Clubdom.com- Ass Fucking of slave 0325
https://img34.imagetwist.com/th/67143/rtt2htvny9ut.jpg (https://imagetwist.com/rtt2htvny9ut/HuFFcp.jpg)
https://img34.imagetwist.com/th/67143/vlsmh6pkar5o.jpg (https://imagetwist.com/vlsmh6pkar5o/UXgHoS.jpg)

Description:
Jamie comes into the slave barn, her high heels click loudly and menacingly on the tole floor. She takes her slave out of the cage and decides to make him her little bitch. Jamie_s favorite thing to do is to fuck the new slaves with her huge strap-on cock. She shoves her huge cock in his mouth while he is pinned onto the floor. He cannot move and sucks away while she taunts him. Soon she shoves him onto the bench and makes him into her fuck puppet and finishes him with a pile-driver. He is all used up now
Model:
Jamie Valentine
Studio:
Clubdom.com
Info:
File Name : cd_s986_jamievalentine_strapon.mp4
File Size : 688.54 MB
Resolution : 1920x1080
Duration : 00:07:57

Download K2S VIDEO:
Keep2Share Video: cd_s986_jamievalentine_strapon.mp4 (https://k2s.cc/file/19f381b0d4cd2)

Clit
02-04-2025, 07:42 PM
Clubdom.com- Elena & Sabrina- Whipped Meat
https://img401.imagetwist.com/th/67142/biu9xcack79q.jpg (https://imagetwist.com/biu9xcack79q/VGcLkN.jpg)
https://img69.imagetwist.com/th/67142/7e2ls0ommh98.jpg (https://imagetwist.com/7e2ls0ommh98/sipgIkPn.jpg)

Description:
Elena Koshka and Sabrina Paige are on a mission to inflict as much pain to their slave as possible. They whip him mercilessly and use a spiked wall paper roller to watch him squirm, all for their pleasure. These women know that they have total control over him, and it turns them on. The lesbian lovers are all about tormenting guys to get their pussies wet as foreplay for their sexual escapades and this man is only one of their many victims. He must suffer lash after lash, just to get them wet.
Model:
Elena Koshka, Sabrina Paige
Studio:
Clubdom.com
Info:
File Name : cd_s982_elenakoshka_sabrinapaige_whipping.mp4
File Size : 733.68 MB
Resolution : 1920x1080
Duration : 00:08:30

Download K2S VIDEO:
Keep2Share Video: cd_s982_elenakoshka_sabrinapaige_whipping.mp4 (https://k2s.cc/file/239078ee03d21)

Clit
02-04-2025, 07:55 PM
Clubdom.com- Alexia Jordan Whips The Slave
https://img202.imagetwist.com/th/67164/8uuonwt57ef0.jpg (https://imagetwist.com/8uuonwt57ef0/HUwRnUk.jpg)
https://img401.imagetwist.com/th/67164/imvjpcpjd8p0.jpg (https://imagetwist.com/imvjpcpjd8p0/CZWVwPB.jpg)

Description:
Watch as Alexia Jordan lets her caged slave out and ties him up because he was being bad, then whips him till he begs the safe word..
Model:
Alexia Jordon
Studio:
Clubdom.com
Info:
File Name : cd_s537_alexia_jordan_whipping.mp4
File Size : 447.03 MB
Resolution : 1920x1080
Duration : 00:05:16

Download K2S VIDEO:
Keep2Share Video: cd_s537_alexia_jordan_whipping.mp4 (https://k2s.cc/file/501939c2996e0)

Clit
02-04-2025, 08:27 PM
Clubdom.com- Esmi Lee Strap On Fucking
https://img34.imagetwist.com/th/67155/oc9zm0f019li.jpg (https://imagetwist.com/oc9zm0f019li/TLbIiMv.jpg)
https://img119.imagetwist.com/th/67156/hz3t2iuusv7g.jpg (https://imagetwist.com/hz3t2iuusv7g/gRiYOsaq.jpg)

Description:
ClubDom, In Our World Women Rule. Mistress Cheyenne has got her slave by the balls and isn_t going to let him off easy It_s ball busting time In Our World ..
Model:
Esmi Lee
Studio:
Clubdom.com
Info:
File Name : cd_s1069_esmilee_strapon.mp4
File Size : 460.8 MB
Resolution : 1920x1080
Duration : 00:05:21

Download K2S VIDEO:
Keep2Share Video: cd_s1069_esmilee_strapon.mp4 (https://k2s.cc/file/2664c6180f6e3)

Clit
02-04-2025, 08:34 PM
Clubdom.com- Punished By the Fur Mistress
https://img119.imagetwist.com/th/67134/p8rtroqgjzzq.jpg (https://imagetwist.com/p8rtroqgjzzq/HfBTrJby.jpg)
https://img202.imagetwist.com/th/67134/ko8mza8zrvof.jpg (https://imagetwist.com/ko8mza8zrvof/DWXCQuiv.jpg)

Description:
Mistress Aleana is angry and calls her slave boy over and drags him over her knee. She torments him with how good her fur coat feels on his skin but it turns out, he does not deserve that pleasure, he deserves a severe OTK punishment for leaving her beautiful fur coat on the floor and not taking it to the dry cleaners. He tries to plea but he knows he is wrong and she dishes out a very harsh OTK that he will not soon forget, making his ass more and more red with each heavy swat and leg locking him into position so he cannot get away.
Model:
Alina Long
Studio:
Clubdom.com
Info:
File Name : furcoatotkspanking.mp4
File Size : 152.88 MB
Resolution : 854x480
Duration : 00:05:52

Download K2S VIDEO:
Keep2Share Video: furcoatotkspanking.mp4 (https://k2s.cc/file/8d60bf5fa68cd)

Clit
02-04-2025, 08:36 PM
Clubdom.com- Nikki Brook and Santa_s Boot
https://img401.imagetwist.com/th/67160/fku3a44o9c86.jpg (https://imagetwist.com/fku3a44o9c86/kgmRBZ.jpg)
https://img119.imagetwist.com/th/67160/2rx5ainz7h17.jpg (https://imagetwist.com/2rx5ainz7h17/pQjECdj.jpg)

Description:
Madame Nikki Brooks wants to see how well her slave bitch can worship her boots. Madame Nikki is pleased at his ability to follow her directions, and has her pathetic slave eagerly sucking, licking and slurping her boots until she notices he has got an erection without asking. She has him jerk his pathetic slut stick off on her boots before making him slurp up his filth.
Model:
Nikki Brooks
Studio:
Clubdom.com
Info:
File Name : cd_s1111_nikkibrooks_bootjerkoff.mp4
File Size : 570.19 MB
Resolution : 1920x1080
Duration : 00:06:35

Download K2S VIDEO:
Keep2Share Video: cd_s1111_nikkibrooks_bootjerkoff.mp4 (https://k2s.cc/file/1ec0a96bd4bad)

Clit
02-04-2025, 08:53 PM
Clubdom.com- Over-Powered by Femdom Cock
https://img166.imagetwist.com/th/67138/lc8yflcm4otm.jpg (https://imagetwist.com/lc8yflcm4otm/CWpxSJ.jpg)
https://img166.imagetwist.com/th/67138/ne0w8w4lk3x3.jpg (https://imagetwist.com/ne0w8w4lk3x3/tkoxEv.jpg)

Description:
This slave was given the slave number 019 by the women at the Order Of Indomitus. The women of the Order have brought him here to be loaned out and of use to the Clubdom Mistresses. He gets overly excited but, the women must teach this slave a lesson in humility....with their superior Femdom cocks Lydia Supremacy, slave 019_s owner goes first, making him deep-throat her dick while verbally degrading him. Next he is bent over the bench and fucked deep and hard while Lydia rides his ass, shoving his mouth on Jean_s cock while Lynn strokes hers and smiles, hoping she will get a turn. The slave is over-powered and weak, and must take cock in both holes to remind him of his place, at their feet, with these women in charge, always.
Model:
Jean Bardot
Studio:
Clubdom.com
Info:
File Name : cd_s961_lynnpops_jeanbartdot_lydiasupremacy_strapo nbartfilm.mp4
File Size : 526.15 MB
Resolution : 1920x1080
Duration : 00:06:06

Download K2S VIDEO:
Keep2Share Video: cd_s961_lynnpops_jeanbartdot_lydiasupremacy_strapo nbartfilm.mp4 (https://k2s.cc/file/bb71b584f960a)

Clit
02-04-2025, 08:53 PM
Clubdom.com- Domina Reseases Him from Cage
https://img119.imagetwist.com/th/67167/e0zycdsgtrqd.jpg (https://imagetwist.com/e0zycdsgtrqd/LQmGyfH.jpg)
https://img202.imagetwist.com/th/67167/6kne78dki4za.jpg (https://imagetwist.com/6kne78dki4za/OOrVcg.jpg)

Description:
Mistress Dahlia and Domina Helena are standing in front of a cage for you, mocking the size of your itty bitty little clitty. They cosy up to each other and rub each other over their latex lingerie. Don_t you wish you could touch a gorgeous Goddess, but they don_t allow miserable pathetic slaves that pleasure?
Model:
Dahlia Rain, Domina Helena
Studio:
Clubdom.com
Info:
File Name : cd_s1122_mistressdahlia_dominahelena_pov.mp4
File Size : 480.49 MB
Resolution : 1920x1080
Duration : 00:05:34

Download K2S VIDEO:
Keep2Share Video: cd_s1122_mistressdahlia_dominahelena_pov.mp4 (https://k2s.cc/file/1899d714e1e3d)

Clit
02-04-2025, 08:57 PM
Clubdom.com- Cock Slut for the Queen
https://img166.imagetwist.com/th/67149/pftr34nokeo8.jpg (https://imagetwist.com/pftr34nokeo8/bnAKcbqf.jpg)
https://s10.imagetwist.com/th/67149/15t93feg3xng.jpg (https://imagetwist.com/15t93feg3xng/jAfoEvjK.jpg)

Description:
There you are cock slut, kneeling before your QUEEN, begging for cock in your little slut mouth. Your Queen, your Goddess has you trained well. She is in a good mood and decides she is going to give it to you. She makes you take her big hard cock into your mouth. You will behave and take it all, taking her every direction.
Model:
Goddess Amadahy, Queen Qandisa
Studio:
Clubdom.com
Info:
File Name : cd_s1047_qandisa_amadahy_pov1.mp4
File Size : 437.55 MB
Resolution : 1920x1080
Duration : 00:05:05

Download K2S VIDEO:
Keep2Share Video: cd_s1047_qandisa_amadahy_pov1.mp4 (https://k2s.cc/file/b11e8ad680571)

Clit
02-04-2025, 09:08 PM
Clubdom.com- Stroke For Your Goddesses
https://img119.imagetwist.com/th/67149/ow035yxy0mmp.jpg (https://imagetwist.com/ow035yxy0mmp/UttLYBsM.jpg)
https://img166.imagetwist.com/th/67149/bkngc9visqiz.jpg (https://imagetwist.com/bkngc9visqiz/twyccQlb.jpg)

Description:
You are not and never will be worthy enough to have your filthy tongue or hands on the skin of Queen Qandisa and Goddess Amadahy. Instead you will be on your knees like the pathetic small dicked loser that you are, stroking your tiny dick and following every humiliating, demeaning instruction that these women give to you.
Model:
Goddess Amadahy, Queen Qandisa
Studio:
Clubdom.com
Info:
File Name : cd_s1043_qandisa_amadahy_pov1.mp4
File Size : 553.84 MB
Resolution : 1920x1080
Duration : 00:06:26

Download K2S VIDEO:
Keep2Share Video: cd_s1043_qandisa_amadahy_pov1.mp4 (https://k2s.cc/file/10e0891b31c5e)

Clit
02-04-2025, 09:09 PM
Clubdom.com- WTF Chocolates for Valentines
https://img202.imagetwist.com/th/67168/n9aj38uqhcts.jpg (https://imagetwist.com/n9aj38uqhcts/wWTpCJ.jpg)
https://img119.imagetwist.com/th/67168/5806yzo1g2bf.jpg (https://imagetwist.com/5806yzo1g2bf/oGAVeza.jpg)

Description:
Goddess Nadia White and Goddess Nyssa Nevers punish their thoughtless slave who thought it was a good idea to bring them chocolates and roses for Valentine_s Day. Goddess Nadia and Goddess Nyssa mock his attempt to get them gifts, as if he knew what could possibly make his Goddesses happy. Instead of wanting bullshit gifts, Goddess Nadia and Goddess Nyssa want a slave who knows how to take a cock like a good whore. Goddess Nadia forces the worthless slave to slobber all over Goddess Nyssa_s big black dick before stuffing his mouth with her own strap on down his throat. The Goddesses take turns fucking their slave_s mouth until their cocks are wet with his spit. That_s when they bend him over and start pegging his tight man-pussy. Goddess Nadia shoves her cock up his slut hole while pulling him back by his harness so he is forced to take the whole cock up his chute. After Goddess Nyssa makes him hold a ridiculous rose in his mouth, she takes up position the slave so she can DP his ass with Goddess Nadia. When Goddess Nadia and Goddess Nyssa have their fill of their slave, they leave him a mess on the floor with one rose sticking out of his ass, hoping he will grow a rose bush in his worthless hole.
Model:
Nadia White, Nyssa Nevers
Studio:
Clubdom.com
Info:
File Name : cd_s1133_nadiawhite_nyssanevers_valentinesstrapon. mp4
File Size : 696.51 MB
Resolution : 1920x1080
Duration : 00:08:05

Download K2S VIDEO:
Keep2Share Video: cd_s1133_nadiawhite_nyssanevers_valentinesstrapon. mp4 (https://k2s.cc/file/ab01281e29086)

Clit
02-04-2025, 09:10 PM
Clubdom.com- Michelle and Tangent_s Auction Slave 5- Suck for your Goddesses
https://img119.imagetwist.com/th/67144/ua7dqt0nsym2.jpg (https://imagetwist.com/ua7dqt0nsym2/ITsiktMn.jpg)
https://img69.imagetwist.com/th/67144/py0ypcjpfiuw.jpg (https://imagetwist.com/py0ypcjpfiuw/XQrkuBqf.jpg)

Description:
Michelle and Tangent smoke cigarettes and stroke their big black cocks and tell you how they exactly want to stretch and use your ass for their pleasure while also using your ass as their ashtray. Be a good bitch and open up wide for them....both holes. You need to please them as they pound away fucking you harder and harder for their amusement.
Model:
Goddess Tangent, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : cd_s992_5-8_michellelacy_goddesstangent_straponpov.mp4
File Size : 525.37 MB
Resolution : 1920x1080
Duration : 00:06:06

Download K2S VIDEO:
Keep2Share Video: cd_s992_5-8_michellelacy_goddesstangent_straponpov.mp4 (https://k2s.cc/file/8253470eebf2f)

Clit
02-04-2025, 09:20 PM
Clubdom.com- Bruised For Goddess CBT
https://img34.imagetwist.com/th/67149/v6z6ul1bp907.jpg (https://imagetwist.com/v6z6ul1bp907/aASOjlqn.jpg)
https://img202.imagetwist.com/th/67149/q23q9iz8ykzi.jpg (https://imagetwist.com/q23q9iz8ykzi/tEkXGW.jpg)

Description:
Queen Qandisa and Goddess Amadahy are on a mission to bruise up their slave_s balls. They drag him in and tell him that he is in for it. Say THANK YOU GODDESS. Louder Shouts Amadahy at her toy. The women restrain him and begin to crop his already throbbing balls which were busted earlier in the day by their kicks. The women inspect to see if his balls are bruised enough while they verbally torment him and even make him lick Amadahy_s armpit and spit.
Model:
Goddess Amadahy, Queen Qandisa
Studio:
Clubdom.com
Info:
File Name : cd_s1041_qandisa_amadahy_cbt.mp4
File Size : 548.74 MB
Resolution : 1920x1080
Duration : 00:06:22

Download K2S VIDEO:
Keep2Share Video: cd_s1041_qandisa_amadahy_cbt.mp4 (https://k2s.cc/file/6937aa08623ec)

Clit
02-04-2025, 09:26 PM
Clubdom.com- Beg for Her Cane
https://s10.imagetwist.com/th/67169/cjgenzd8jcrs.jpg (https://imagetwist.com/cjgenzd8jcrs/kkDKczj.jpg)
https://s10.imagetwist.com/th/67169/bu40k9sjrj4n.jpg (https://imagetwist.com/bu40k9sjrj4n/HXoLZKMv.jpg)

Description:
Goddess Alexia Jordon warms up on his pathetic balls making him beg to be caned till the end. Stroke after stroke she canes his ass till it is hot, red and swollen. There is no Mercy, for his only function in life is to amuse and please her by being a pathetic slave ...begging for mercy....
Model:
Alexia Jordon
Studio:
Clubdom.com
Info:
File Name : cd_s533_alexia_jordan_caining.mp4
File Size : 556.1 MB
Resolution : 1920x1080
Duration : 00:06:27

Download K2S VIDEO:
Keep2Share Video: cd_s533_alexia_jordan_caining.mp4 (https://k2s.cc/file/f8da79c8d89ca)

Clit
02-04-2025, 09:31 PM
Clubdom.com- Fuck-Table for Hot Young Mistresses
https://img69.imagetwist.com/th/67133/y48blr5y92o4.jpg (https://imagetwist.com/y48blr5y92o4/XmAAhRX.jpg)
https://img34.imagetwist.com/th/67133/y4lxk68u33b2.jpg (https://imagetwist.com/y4lxk68u33b2/ggFtnP.jpg)

Description:
This slave better stay hard and please Mistress Raven or else Mistress Isobel is going to castrate him. There_s a catch: he_s not allowed to cum Mistress Ricky smothers the slave and keeps him excited while Raven pleasures herself on his huge hard dick. This slave_s huge hard dick is why these ladies keep him around as their fuck toy, after all. Raven gets wetter and wetter bouncing up and down on his cock making herself cum while Ricky smothers him with her beautiful young ass and pussy. They love controlling him, and his orgasm. Oh no It looks like he came...
Model:
Isobel Devi
Studio:
Clubdom.com
Info:
File Name : s917ravenisobelrickyfucksmother.mp4
File Size : 405.46 MB
Resolution : 1920x1080
Duration : 00:04:05

Download K2S VIDEO:
Keep2Share Video: s917ravenisobelrickyfucksmother.mp4 (https://k2s.cc/file/7b02ebe53dd06)

Clit
02-04-2025, 09:39 PM
Clubdom.com- Splitting Open Your Mouth-Hole POV
https://img69.imagetwist.com/th/67147/g1qpzqi69aj2.jpg (https://imagetwist.com/g1qpzqi69aj2/zUXhxAl.jpg)
https://img34.imagetwist.com/th/67147/h5cgjcak6upx.jpg (https://imagetwist.com/h5cgjcak6upx/QgvCFjW.jpg)

Description:
Michelle Lacy, Goddess Tangent and Paulina Amore are here to make sure that your mouth hole is thoroughly trained to suck cock. Just sucking cock is not going to be good enough for these sadistic women, they are going to be splitting open your mouth on their GIANT cocks, laughing, shoving your head down onto them while you gag and suffer You were born to be their cock-sucking, gagging, whimpering little obedient bitch.
Model:
Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : cd_s1028_tangent_michellelacy_paulinaamore_pov.mp4
File Size : 403 MB
Resolution : 1920x1080
Duration : 00:04:42

Download K2S VIDEO:
Keep2Share Video: cd_s1028_tangent_michellelacy_paulinaamore_pov.mp4 (https://k2s.cc/file/ed72a35b503f1)

Clit
02-04-2025, 09:43 PM
Clubdom.com- Field Whipping
https://img119.imagetwist.com/th/67139/3n7l7hmk5jre.jpg (https://imagetwist.com/3n7l7hmk5jre/jfXHezWT.jpg)
https://img202.imagetwist.com/th/67139/5fd5t6tyxihf.jpg (https://imagetwist.com/5fd5t6tyxihf/lDyvRW.jpg)

Description:
Jean Bardot, Lydia Supremacy and Lynn Pops hang their slave strung up outside. Sweat drips from his body as the ladies grin. He is in for a nasty thrashing. The women take turns laying into him with their whips as they taunt and threaten him. He cries out but they do not care or are they willing to show him any mercy. Here at Clubdom, he is their meat puppet, just a fleshy bag for them to unleash their dominant wrath upon. Make him suffer Ms. Lydia says sadistically to the other ladies. Soon it is her turn to whip him mercilessly.
Model:
Jean Bardot, Lydia Supremacy
Studio:
Clubdom.com
Info:
File Name : cd_s964_lynnpops_jeanbartdot_lydiasupremacy_whippi ngandrew.mp4
File Size : 593.51 MB
Resolution : 1920x1080
Duration : 00:06:47

Download K2S VIDEO:
Keep2Share Video: cd_s964_lynnpops_jeanbartdot_lydiasupremacy_whippi ngandrew.mp4 (https://k2s.cc/file/eb5927a2154a8)

Clit
02-04-2025, 10:04 PM
Clubdom.com- Caught by the Guardesses Part 1- Whipping
https://img202.imagetwist.com/th/67137/222mb8tawmub.jpg (https://imagetwist.com/222mb8tawmub/PQYOqeHh.jpg)
https://img166.imagetwist.com/th/67137/p97berda57tv.jpg (https://imagetwist.com/p97berda57tv/GOypkYM.jpg)

Description:
The Guardesses Paris and Jamie catch this man spying on them. He had been hiding on the side of the compound when a slave saw and reported him to the Mistresses. Paris kicks out the block he was standing on to make the spy dangle helplessly. Jaime and Paris both begin interrogating him, using their whips to make him talk. They will soon break him.
Model:
Jamie Valentine, Paris Knight
Studio:
Clubdom.com
Info:
File Name : cd_s955_1-4_jamievalentine_paris_whippingbitch.mp4
File Size : 718.1 MB
Resolution : 1920x1080
Duration : 00:07:09

Download K2S VIDEO:
Keep2Share Video: cd_s955_1-4_jamievalentine_paris_whippingbitch.mp4 (https://k2s.cc/file/b098e14cd510b)

Clit
02-04-2025, 10:08 PM
Clubdom.com- Borrowing A Slave_s Ass
https://img119.imagetwist.com/th/67171/97o21wbufpps.jpg (https://imagetwist.com/97o21wbufpps/Tchqrb.jpg)
https://img69.imagetwist.com/th/67171/4jig76nhs8ax.jpg (https://imagetwist.com/4jig76nhs8ax/hoPvlJ.jpg)

Description:
Mistress Lydia Supremacy and Mistress Cheyenne borrow a slave from their friend to train his pathetic ass how to take a cock. Mistress Cheyenne shoves her strap on cock in his throat so the slave can drool and choke all over it. Soon, Mistress Lydia and Mistress Cheyenne have the slave bent over where Mistress Cheyenne spreads his man pussy open so Mistress Lydia can shove her long hand held cock deep in his gaping unused hole. After Mistress Lydia loosens him up, Mistress Cheyenne gives him the rough ride she promised him, pegging his tight virgin man pussy. Mistress Cheyenne then starts pile drive pegging his ass, making sure he_s ready to be able to take any dick his Mistress can stuff in him, and leaving him craving for more cock.
Model:
Goddess Cheyenne, Lydia Supremacy, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : cd_s1132_mistresslydia_mistresscheyenne_strapon.mp 4
File Size : 524 MB
Resolution : 1920x1080
Duration : 00:06:05

Download K2S VIDEO:
Keep2Share Video: cd_s1132_mistresslydia_mistresscheyenne_strapon.mp 4 (https://k2s.cc/file/9937a040760ff)

Clit
02-04-2025, 10:27 PM
Clubdom.com- Earn Your Orgasm POV
https://img119.imagetwist.com/th/67169/hdwd5rgrhrmo.jpg (https://imagetwist.com/hdwd5rgrhrmo/vtCNOV.jpg)
https://img34.imagetwist.com/th/67169/6qg8jpsfch2a.jpg (https://imagetwist.com/6qg8jpsfch2a/pUFTVnIH.jpg)

Description:
Goddess Cheyenne and Amadahy know you_ve been jerking off to their videos. They feel you need to earn your orgasm just like personal slaves. They want you to gather the following items: a candle, lighter, ruler or wooden spoon and meet Them on your knees. Amadahy and Cheyenne are going to allow you cum and spill that nasty male filth at their boots. First, you must suffer. On a personal note to you new cyber slaves, feel free to snap some pics and send them to us or better yet post them on social media We would enjoy that tremendously.
Model:
Cheyenne Jewel, Goddess Amadahy
Studio:
Clubdom.com
Info:
File Name : cd_s510_cheyenne_jewel_amadahy_pov.mp4
File Size : 558.11 MB
Resolution : 1920x1080
Duration : 00:06:28

Download K2S VIDEO:
Keep2Share Video: cd_s510_cheyenne_jewel_amadahy_pov.mp4 (https://k2s.cc/file/12fc4fc365158)

Clit
02-04-2025, 10:31 PM
Clubdom.com- Esmi_s Halloween Party Part 1
https://img119.imagetwist.com/th/67152/0bvunc9465ct.jpg (https://imagetwist.com/0bvunc9465ct/kkDFzUr.jpg)
https://img119.imagetwist.com/th/67152/yrf5rxu4opmt.jpg (https://imagetwist.com/yrf5rxu4opmt/RnyGew.jpg)

Description:
Esmi and her obedient man-pet are having a special kind of Halloween Party. It is set up to enslave the jock next door neighbor who she knows has had his eye on her. The jock boy arrives and soon learns that this party is a private affair, and all about what Esmi wants. He gets on his knees as he is told to see what this is all about, and to his surprise, she pulls out a vibrating dildo and starts playing with her pussy with it. She allows both of the enslaved men to taste her pussy on the dildo and knows they are easily controlled by her.
Model:
Esmi Lee
Studio:
Clubdom.com
Info:
File Name : cd_s1065_1-2_esmilee_teasehw.mp4
File Size : 471.05 MB
Resolution : 1920x1080
Duration : 00:05:30

Download K2S VIDEO:
Keep2Share Video: cd_s1065_1-2_esmilee_teasehw.mp4 (https://k2s.cc/file/0bdf1fb383c5e)

Clit
02-04-2025, 10:36 PM
Clubdom.com- Esmi Lee Gets Ass Worship
https://img34.imagetwist.com/th/67155/3i4eu7w5qwnq.jpg (https://imagetwist.com/3i4eu7w5qwnq/EeodrEP.jpg)
https://img166.imagetwist.com/th/67155/z91ys22lczvh.jpg (https://imagetwist.com/z91ys22lczvh/PXEqLKG.jpg)

Description:
ClubDom, In Our World Women Rule. Mistress Cheyenne has got her slave by the balls and isn_t going to let him off easy It_s ball busting time In Our World ..
Model:
Esmi Lee
Studio:
Clubdom.com
Info:
File Name : cd_s1067_esmilee_assworship.mp4
File Size : 460.27 MB
Resolution : 1920x1080
Duration : 00:05:20

Download K2S VIDEO:
Keep2Share Video: cd_s1067_esmilee_assworship.mp4 (https://k2s.cc/file/a2585d966eda2)

Clit
02-04-2025, 10:42 PM
Clubdom.com- Inga Victoria- Pussy For Dinner Part 2
https://img202.imagetwist.com/th/67135/cj1cvdxjj36q.jpg (https://imagetwist.com/cj1cvdxjj36q/inuXNQ.jpg)
https://img166.imagetwist.com/th/67135/g9tvhq2v57dt.jpg (https://imagetwist.com/g9tvhq2v57dt/oYASSJQc.jpg)

Description:
Slave 009 is exhausted and has only been fed a few scraps over the past 3 days while Goddess Inga Victoria has him working outside landscaping her new house non-stop. He has been worked hard and collapses from exhaustion and decides to go into the house to beg her for an actual meal. She agrees and has a wonderful dinner prepared on the table for him. Just before she gives him permission to eat, she decides to give him a choice instead....food or her pussy? He cannot help it but choose her pussy as he has been fantasizing about what this would be like ever since she enslaved him 6 months ago. Besides, what if this is what Mistress wants and he chooses food over her? That could be seen as disrespectful. He must choose her. Slave 009 goes to town eating her pussy from every angle she poses her sexy self in and pleasures her as best he can. She tastes so incredible, even better than he could ever fantasize about. She is so wet, he did not know a pussy could taste this good.
Model:
Inga Victoria
Studio:
Clubdom.com
Info:
File Name : s9472-3ingavictoriaasslick.mp4
File Size : 324.8 MB
Resolution : 1920x1080
Duration : 00:05:28

Download K2S VIDEO:
Keep2Share Video: s9472-3ingavictoriaasslick.mp4 (https://k2s.cc/file/321dde0b2abe7)

Clit
02-04-2025, 10:48 PM
Clubdom.com- Michelle & Tangent Fucking Machine Chindo
https://img69.imagetwist.com/th/67132/gazxountdilb.jpg (https://imagetwist.com/gazxountdilb/vBEgyCuq.jpg)
https://img166.imagetwist.com/th/67132/vh3rmtmw8crn.jpg (https://imagetwist.com/vh3rmtmw8crn/hxIpIYAB.jpg)

Description:
Mistress Michelle Lacy and Goddess Tangent have the slave strapped down and forced to give their visiting friend Mistress Natasha pleasure with a dildo gag. They decide to torture him by having a fucking machine going and going into his ass, faster and harder they turn up the dial. They whip him and yell at him to fuck her harder while they laugh at his hilariously painful and unfortunate situation. He thinks its over, but they just keep turning up the dial on the fucking machine, and go back to whipping him harder and harder.
Model:
Goddess Tangent, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s938michellelacygoddesstangentfuckingmachinechindo .mp4
File Size : 680.48 MB
Resolution : 1920x1080
Duration : 00:06:48

Download K2S VIDEO:
Keep2Share Video: s938michellelacygoddesstangentfuckingmachinechindo .mp4 (https://k2s.cc/file/9dba675527128)

Clit
02-04-2025, 10:51 PM
Clubdom.com- Rub your Little Winky POV
https://img69.imagetwist.com/th/67129/9221l7j3aid6.jpg (https://imagetwist.com/9221l7j3aid6/AIvBekm.jpg)
https://img34.imagetwist.com/th/67130/ym0qy0hu4uhq.jpg (https://imagetwist.com/ym0qy0hu4uhq/tMGdOuWc.jpg)

Description:
Mistress Lydia is inspecting the body of a new slave and can barely contain her laughter when she sees the size of his small penis. Lydia unleashes a barrage of humiliating comments, all belittling him for his shortcomings. Lydia is curious about whether such a tiny dick can actually be jerked to orgasm so she gives the slave permission to masturbate of course, if he succeeds he will eat up his filth in a most humiliating way.
Model:
Lydia Supremacy
Studio:
Clubdom.com
Info:
File Name : cd_s900_michellelacy_natalyasadici_isobeldevil_lyd iasupremacy_natalyapov2.mp4
File Size : 457.09 MB
Resolution : 1920x1080
Duration : 00:05:20

Download K2S VIDEO:
Keep2Share Video: cd_s900_michellelacy_natalyasadici_isobeldevil_lyd iasupremacy_natalyapov2.mp4 (https://k2s.cc/file/3cbee701c7e01)

Clit
02-04-2025, 10:55 PM
Clubdom.com- Nikki Brook_s and The Holiday Slave
https://img202.imagetwist.com/th/67160/pu780fsomdpd.jpg (https://imagetwist.com/pu780fsomdpd/bVktDUU.jpg)
https://img401.imagetwist.com/th/67161/fsye1o34jfxe.jpg (https://imagetwist.com/fsye1o34jfxe/ejrndou.jpg)

Description:
Madame Nikki Brooks is going to send her slave back to the farm where she got him if he can_t fuck her wet pussy good with the chindo she puts on his head. She has known that he has wanted to fuck her for a while now, but his cock is so pathetic and small and would never be allowed to fuck a hot wet pussy of a gorgeous Goddess like Nikki Brooks. Merry Fucking Christmas
Model:
Nikki Brooks
Studio:
Clubdom.com
Info:
File Name : cd_s1112_nikkibrooks_chindo.mp4
File Size : 496.08 MB
Resolution : 1920x1080
Duration : 00:05:42

Download K2S VIDEO:
Keep2Share Video: cd_s1112_nikkibrooks_chindo.mp4 (https://k2s.cc/file/a7ab81e02ad9c)

Clit
02-04-2025, 10:58 PM
Clubdom.com- Milking day for cum slut‏
https://img34.imagetwist.com/th/67167/zdicwcilblpo.jpg (https://imagetwist.com/zdicwcilblpo/QExPYZv.jpg)
https://img166.imagetwist.com/th/67167/6hl3brn1zwja.jpg (https://imagetwist.com/6hl3brn1zwja/IMisvkg.jpg)

Description:
Goddess Amadahy and Cheyenne Jewel have it in for a particular slave. They strap him to a table and wheel him and begin to extract his male filth. The ladies are expecting a full load as the male bitch has been chastity bound for 36 days. Cheyennes soft hands go to work on the slut_s hard cock as Amadahy knows that she will grab his balls and and twist and slap them while goddess Cheyenne extracts the male filth right out of his swollen slut sacks. All the while, Cheyenne reminds the male bitch that if he doesn_t produce enough filth, he will be forced to endure another 36 days of chastity. Either way, this slut loses. When the male bitch gets right to the point of cumming but hold backs, Amadahy puts her hand over his mouth as Cheyenne extracts every drop of the bitch_s male filth. Then they feed him all his nourishment for the next 36 days.
Model:
Cheyenne Jewel, Goddess Amadahy
Studio:
Clubdom.com
Info:
File Name : cd_s508_cheyenne_jewel_amadahy_hj.mp4
File Size : 627.5 MB
Resolution : 1920x1080
Duration : 00:07:16

Download K2S VIDEO:
Keep2Share Video: cd_s508_cheyenne_jewel_amadahy_hj.mp4 (https://k2s.cc/file/37cc1d0c65369)

Clit
02-04-2025, 11:08 PM
Clubdom.com- Michelle- Jerk to my hot body
https://img69.imagetwist.com/th/67130/o4layg3cy0u8.jpg (https://imagetwist.com/o4layg3cy0u8/SMnmpJy.jpg)
https://img34.imagetwist.com/th/67130/sp82f0dvjx84.jpg (https://imagetwist.com/sp82f0dvjx84/mlYSKku.jpg)

Description:
Mistress Michelle Lacy knows the truth just the site of a hot woman like her in latex and boots makes you want to jerk your tiny cock. You are so pathetic that all you deserve from her is her spit in your face. But Michelle does think it is amusing that you are so turned on, so go ahead and stroke that tiny cock. Just imagine what it would be like to feel it inside her beautiful pussy. Yeah right dream on, loser. You are going to cum on her boot by humping it just like a horny and then you are going to eat every last drop back up. Your pathetic cum only belongs inside your body, one way or another.
Model:
Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s898michellelacynatalyasadiciisobeldevillydiapov.m p4
File Size : 384.91 MB
Resolution : 1920x1080
Duration : 00:04:30

Download K2S VIDEO:
Keep2Share Video: s898michellelacynatalyasadiciisobeldevillydiapov.m p4 (https://k2s.cc/file/9fb2cfec5d614)

Clit
02-04-2025, 11:15 PM
Clubdom.com- Spread Cock-Whipped Ass-Kisser
https://img34.imagetwist.com/th/67132/p2br17t0ha7p.jpg (https://imagetwist.com/p2br17t0ha7p/SozcoOCW.jpg)
https://img401.imagetwist.com/th/67132/d3gcp407s794.jpg (https://imagetwist.com/d3gcp407s794/qsYhsaa.jpg)

Description:
The slave is stretched out on his back and completely helpless for the She-Gods. He is forced to kiss Natasha_s ass while Mistress Michelle Lacy and Goddess Tangent laugh and torment his cock with various implements including small thin stinging canes, floggers and more. The ladies demand he worship Natasha_s ass and laugh at him struggling to take it for them. He is turned on by their beauty and power but punished for it as his hard-on is used as a target for their sadism.
Model:
Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s936michellelacygoddesstangentassworship.mp4
File Size : 637.35 MB
Resolution : 1920x1080
Duration : 00:06:22

Download K2S VIDEO:
Keep2Share Video: s936michellelacygoddesstangentassworship.mp4 (https://k2s.cc/file/430d1e366e3c4)

Clit
02-04-2025, 11:33 PM
Clubdom.com- Michelle and Tangent_s Auction Slave 4- Caning
https://img202.imagetwist.com/th/67143/iajxrvlw5o15.jpg (https://imagetwist.com/iajxrvlw5o15/bSWSdOQe.jpg)
https://img34.imagetwist.com/th/67143/ig5s1m4vj590.jpg (https://imagetwist.com/ig5s1m4vj590/FUuOPtGH.jpg)

Description:
Disappointed with how he could not handle a whipping too well, Michelle Lacy and Goddess Tangent decide to try caning their slave to see if he can withstand that. Or maybe the women are just in the mood to inflict pain on their pint-sized new slave? Michelle and Tangent take turns administering hard and fast cane strokes. Their slave needs to see that they mean business and will send him back to the slave farm if he cannot tolerate their torments.
Model:
Goddess Tangent, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : cd_s992_4-8_michellelacy_goddesstangent_caning.mp4
File Size : 717.65 MB
Resolution : 1920x1080
Duration : 00:08:20

Download K2S VIDEO:
Keep2Share Video: cd_s992_4-8_michellelacy_goddesstangent_caning.mp4 (https://k2s.cc/file/7efe0a3f31b06)

Clit
02-04-2025, 11:47 PM
Clubdom.com- Isobel Devi & Veronica Snow Caning
https://img119.imagetwist.com/th/67148/cgyefazul0ix.jpg (https://imagetwist.com/cgyefazul0ix/nxsDOmRR.jpg)
https://s10.imagetwist.com/th/67148/cab977lpph2j.jpg (https://imagetwist.com/cab977lpph2j/MXtukV.jpg)

Description:
Princess Isobel and Mistress Veronica Snow now have their slave in the stockade, his ass exposed, waiting for the pain that is about to come. The Mistresses wield nasty canes and poke and inspect their slave meat. When they are ready, they take turns giving their slave vicious swats until his ass is marked beyond recognition.
Model:
Isobel Devi, Veronica Snow
Studio:
Clubdom.com
Info:
File Name : cd_s1032_isobeldevi_veronicasnow_caning.mp4
File Size : 611.98 MB
Resolution : 1920x1080
Duration : 00:07:06

Download K2S VIDEO:
Keep2Share Video: cd_s1032_isobeldevi_veronicasnow_caning.mp4 (https://k2s.cc/file/60b86bb676ba7)

Clit
02-04-2025, 11:49 PM
Clubdom.com- Brittany Shae & Lexi Luna- Extreme Ball Abuse
https://s10.imagetwist.com/th/67145/j8tkklruafd6.jpg (https://imagetwist.com/j8tkklruafd6/IqyHfbi.jpg)
https://img69.imagetwist.com/th/67145/shu4i41j3yx4.jpg (https://imagetwist.com/shu4i41j3yx4/wzNzpL.jpg)

Description:
Goddess Lexi and Goddess Brittany drag their slave into the room and order him to put his hands behind his back and stand at attention. The strict but gorgeous women laugh at how pathetic his small penis is. The grinning sadists decide to grab his cock and balls and begin to poke at it with their fingernails while telling him that they are going to ballbust him. They make him thank them both for the privilege as his voice trembles to form the words. He knows he will be in for some extreme pain. The cruel women take turns giving him hard kicks, laughing at his pain.
Model:
Brittany Shae
Studio:
Clubdom.com
Info:
File Name : cd_s1000_brittanyshae_lexiluna_ballbust.mp4
File Size : 570.19 MB
Resolution : 1920x1080
Duration : 00:06:39

Download K2S VIDEO:
Keep2Share Video: cd_s1000_brittanyshae_lexiluna_ballbust.mp4 (https://k2s.cc/file/e2936110b29e0)

Clit
02-04-2025, 11:50 PM
Clubdom.com- Goddess Cheyenne & Jean Bardot Whipping
https://img401.imagetwist.com/th/67161/dm6b0fs4ppxh.jpg (https://imagetwist.com/dm6b0fs4ppxh/BHqYaJ.jpg)
https://img202.imagetwist.com/th/67162/5fy4lv8vsewz.jpg (https://imagetwist.com/5fy4lv8vsewz/XPGwOf.jpg)

Description:
Goddess Cheyenne and Mistress Jean Bardot pull a slave needing discipline out of his cage and get him ready to be whipped. After hearing him beg to be whipped, they start lashing his clear back. The Goddesses pause to admire their work before whipping his red lined back again.
Model:
Goddess Cheyenne, Jean Bardot
Studio:
Clubdom.com
Info:
File Name : cd_s1104_goddesscheyenne_mistressjeanbardot_whippi ng.mp4
File Size : 799.27 MB
Resolution : 1920x1080
Duration : 00:09:16

Download K2S VIDEO:
Keep2Share Video: cd_s1104_goddesscheyenne_mistressjeanbardot_whippi ng.mp4 (https://k2s.cc/file/0ed9b69579e87)

Clit
02-05-2025, 12:12 AM
Clubdom.com- Lydia Heard you Were Desparate POV
https://img34.imagetwist.com/th/67159/85egfywu95dc.jpg (https://imagetwist.com/85egfywu95dc/shDcgZWl.jpg)
https://img34.imagetwist.com/th/67159/0dydb4c001eu.jpg (https://imagetwist.com/0dydb4c001eu/gYySyGR.jpg)

Description:
Goddess Lydia Supremacy heard you desparately want to worship her latex covered body. Before you can touch Goddess Lydia or her latex bodysuit, she has a few tasks for you to complete. She wants you to finger your man pussy for her. If you prove you can follow her instructions perfectly, maybe Goddess Lydia will allow you to touch her latex body once or twice.
Model:
Lydia Supremacy
Studio:
Clubdom.com
Info:
File Name : cd_s1092_dahliarain_lydiasupremacy_pov.mp4
File Size : 453.06 MB
Resolution : 1920x1080
Duration : 00:05:16

Download K2S VIDEO:
Keep2Share Video: cd_s1092_dahliarain_lydiasupremacy_pov.mp4 (https://k2s.cc/file/b1511417da507)

Clit
02-05-2025, 12:15 AM
Clubdom.com- Rikki Rumor & Jade Dirty Feet
https://img119.imagetwist.com/th/67130/2f4gommksta0.jpg (https://imagetwist.com/2f4gommksta0/fBZkoh.jpg)
https://img202.imagetwist.com/th/67130/nb102ev3opgx.jpg (https://imagetwist.com/nb102ev3opgx/Tpavvx.jpg)

Description:
ClubDom, In Our World Women Rule. Mistress Cheyenne has got her slave by the balls and isn_t going to let him off easy It_s ball busting time In Our World ..
Model:
Jade Jantzen, Rikki Rumor
Studio:
Clubdom.com
Info:
File Name : s931rikkirumorjadejantzendirtyfeet.mp4
File Size : 466.39 MB
Resolution : 1920x1080
Duration : 00:05:29

Download K2S VIDEO:
Keep2Share Video: s931rikkirumorjadejantzendirtyfeet.mp4 (https://k2s.cc/file/21497ddee1208)

Clit
02-05-2025, 12:18 AM
Clubdom.com- Jamie Valentine & Olivia- Forced-Milking Day
https://img119.imagetwist.com/th/67145/p2n8sxnl534s.jpg (https://imagetwist.com/p2n8sxnl534s/BcPinAVa.jpg)
https://img119.imagetwist.com/th/67145/j9de2gij4ka8.jpg (https://imagetwist.com/j9de2gij4ka8/DHtYznD.jpg)

Description:
It_s milking day at Club Dom and the slave seems to be resistant. Too bad, as Guardesses Jamie Valentine and Olivia Fox are going to get their way, AND their semen specimen. Jamie Valentine threatens the bound slave with a cattle prod as Olivia milks his hard cock. Resisting and not giving them his cum, causes Jamie to shock the slave_s balls until he complies....
Model:
Jamie Valentine, Olivia Fox
Studio:
Clubdom.com
Info:
File Name : cd_s1011_1-5_jamievalentine_oliviafox_milking.mp4
File Size : 657.47 MB
Resolution : 1920x1080
Duration : 00:07:36

Download K2S VIDEO:
Keep2Share Video: cd_s1011_1-5_jamievalentine_oliviafox_milking.mp4 (https://k2s.cc/file/2584d8cdba769)

Clit
02-05-2025, 12:33 AM
Clubdom.com- Qandisa & Amadhy Whipping
https://img202.imagetwist.com/th/67149/hirg91tcdqnk.jpg (https://imagetwist.com/hirg91tcdqnk/dPnjDol.jpg)
https://s10.imagetwist.com/th/67150/nyk8be3nkwk1.jpg (https://imagetwist.com/nyk8be3nkwk1/KfCdjSg.jpg)

Description:
Eeny, Meenie, Minie, Moe... Queen Qandisa taunts the strung up slaves at the whipping post. She toys with them with her whip, making them jump. Just wait until Goddess Amadahy gets here, with her nine whips of fury Amadahy arrives by pony cart and has the whips in her hand. She looks disappointed as she expected better men but they will have to do. She cracks her single tail across the backs of both of the slaves, seeing who will scream louder than the other until both of the slaves are shredded. She and Qandisa inspect both slaves closely and decide they need even more...
Model:
Goddess Amadahy, Queen Qandisa
Studio:
Clubdom.com
Info:
File Name : cd_s1050_qandisa_amadahy_whipping.mp4
File Size : 1079.05 MB
Resolution : 1920x1080
Duration : 00:12:31

Download K2S VIDEO:
Keep2Share Video: cd_s1050_qandisa_amadahy_whipping.mp4 (https://k2s.cc/file/5b530cf29a441)

Clit
02-05-2025, 12:59 AM
Clubdom.com- Esmi_s Halloween POV
https://img401.imagetwist.com/th/67152/3wgow7tdyih0.jpg (https://imagetwist.com/3wgow7tdyih0/PoCGdW.jpg)
https://img401.imagetwist.com/th/67152/8f1accgqj0ol.jpg (https://imagetwist.com/8f1accgqj0ol/qrXbDF.jpg)

Description:
You can enjoy being a part of Esmi_s party by being her entertainment. Kneeling and ready for her orders, you cannot help but to become excited at the sight of her gorgeous body. You must do as Esmi says if you are to have any permission to cum, no matter how degrading it is. Sticking your fingers up your ass for her and stroking your pathetic excuse for a dick is a good start to pleasing her.
Model:
Esmi Lee
Studio:
Clubdom.com
Info:
File Name : cd_s1066_esmilee_pov-hw.mp4
File Size : 449.79 MB
Resolution : 1920x1080
Duration : 00:05:14

Download K2S VIDEO:
Keep2Share Video: cd_s1066_esmilee_pov-hw.mp4 (https://k2s.cc/file/d49b3a6ad0b26)

Clit
02-05-2025, 01:04 AM
Clubdom.com- Nikki Trains Your Sissy Slut-hole POV
https://img202.imagetwist.com/th/67157/blq9qtsdichv.jpg (https://imagetwist.com/blq9qtsdichv/NGIonwgL.jpg)
https://img166.imagetwist.com/th/67157/rrp56hd5eqck.jpg (https://imagetwist.com/rrp56hd5eqck/IFVtJcKo.jpg)

Description:
Goddess Nikki Brooks is amused that you took it upon yourself to start masturbating. She stands over you forcing you to watch her stroke her thick black cock. Goddess Nikki gives you instructions on how to stroke your pathetic slut stick and tells you what she is going to do to your tight man pussy if you don_t obey her.
Model:
Nikki Brooks
Studio:
Clubdom.com
Info:
File Name : cd_s1073_nikkibrooks_pov.mp4
File Size : 728.12 MB
Resolution : 1920x1080
Duration : 00:08:25

Download K2S VIDEO:
Keep2Share Video: cd_s1073_nikkibrooks_pov.mp4 (https://k2s.cc/file/1172ae5e44cb8)

Clit
02-05-2025, 01:16 AM
Clubdom.com- Jaime Valentine- Draining Your Slutty Balls
https://img119.imagetwist.com/th/67128/5i0bdszie6vq.jpg (https://imagetwist.com/5i0bdszie6vq/rMuLBX.jpg)
https://img166.imagetwist.com/th/67128/dovgxwgju5tw.jpg (https://imagetwist.com/dovgxwgju5tw/ffRAxRX.jpg)

Description:
Goddess Jamie Valentine has had you locked in chastity for 40 days and now decides it_s time to drain those slutty balls of all their manfilth, She strokes her slaves slut stick hard and fast edging him bringing him right to the brink, Then lets go and laughs at his suffering, Then finally after several minutes of her violent milking your ball explode leaving a huge load of filth for her to feed you slut
Model:
Jamie Valentine
Studio:
Clubdom.com
Info:
File Name : s881jaimevalentinemilking.mp4
File Size : 647.53 MB
Resolution : 1920x1080
Duration : 00:07:29

Download K2S VIDEO:
Keep2Share Video: s881jaimevalentinemilking.mp4 (https://k2s.cc/file/da01c97059104)

Clit
02-05-2025, 01:28 AM
Clubdom.com- Jamie Valentine- Suffer to Cum
https://img401.imagetwist.com/th/67142/hke68h9w8mhc.jpg (https://imagetwist.com/hke68h9w8mhc/imLtXQxF.jpg)
https://img69.imagetwist.com/th/67142/46bj4rqkup7y.jpg (https://imagetwist.com/46bj4rqkup7y/PZNCmI.jpg)

Description:
Jamie Valentine has her slave all strung up and waiting for her. Today is the day he gets his slut-sack milked but not without him suffering greatly for it first. Jamie wants to make sure his balls are very sore when she finally squeezes that las drop of man filth out of his body. Jamie strokes him but stops to kick him in the nuts while laughing at how much pain he is in. She goes back and forth between giving him pleasure and such awful pain. If he is going to cum, she is going to tease, hurt and torment him for her entertainment in order for him to be able to do it. She is not here for his pleasure, he exists for hers.
Model:
Jamie Valentine
Studio:
Clubdom.com
Info:
File Name : cd_s984_jamievalentine_handjob.mp4
File Size : 662 MB
Resolution : 1920x1080
Duration : 00:07:41

Download K2S VIDEO:
Keep2Share Video: cd_s984_jamievalentine_handjob.mp4 (https://k2s.cc/file/1b25fd73e2f2a)

Clit
02-05-2025, 01:47 AM
Clubdom.com- Natalie, Paris, & Michelle StrapOn
https://img34.imagetwist.com/th/67129/my4acmz1xlla.jpg (https://imagetwist.com/my4acmz1xlla/LrrOSNrZ.jpg)
https://img119.imagetwist.com/th/67129/dgadydl0cckc.jpg (https://imagetwist.com/dgadydl0cckc/DUMZpLv.jpg)

Description:
Militant drilling might mean something different to you, but at Clubdom it means the drilling of slave_s fuck-holes by gorgeous, sadistic women with enormous superior Femdom cocks. Mistresses Michelle Lacy, Paris and Natalie begin stroking their cocks, laughing. Michelle tells the other girls that its time to impale them on their cocks. The girls have the helpless pieces of meat bent over and take turns turning the men into crying bitches. Mistress Natalie is especially into it, as she shouts at her slave to take her big cock while the other girls pump away at any available slave hole. Mistress Natalie greatly impresses Mistress Michelle Lacy and Paris as she feeds the slave his own ass by shoving her cock out of his ass and into his mouth. This is a strap-on clip you will never forget.
Model:
Michelle Lacy, Natalia Starr, Paris Knight
Studio:
Clubdom.com
Info:
File Name : s912nataliaparisknightmichellestrapon.mp4
File Size : 796.07 MB
Resolution : 1920x1080
Duration : 00:09:15

Download K2S VIDEO:
Keep2Share Video: s912nataliaparisknightmichellestrapon.mp4 (https://k2s.cc/file/831ff14c3c375)

Clit
02-05-2025, 01:56 AM
Clubdom.com- Alina Long & Sasha Femdom Sex
https://img69.imagetwist.com/th/67163/hfd5fz7z47kc.jpg (https://imagetwist.com/hfd5fz7z47kc/oMDmleo.jpg)
https://img166.imagetwist.com/th/67164/xutq8m3g133p.jpg (https://imagetwist.com/xutq8m3g133p/Fnhlyzo.jpg)

Description:
Mistress Sasha and Goddess Alina look forward to milking day on the ClubDom Estate. They strap the slave into a bondage chair and stroke the slave_s cock nice and slow. Sasha proceeds to fuck the pathetic slave. However he is unable to keep his erection. The slave is resistant because he knows that is orgasm will ultimately be ruined and he will made to consume his own filth. As hard as the slave tries to resist the ladies seductive hands his body betrays him. Sasha catches his filth her hand. Alina holds the slave_s mouth open as smiles as Sasha force feeds the slut every last drop.
Model:
Alina Long
Studio:
Clubdom.com
Info:
File Name : cd_s562_alina_long_sasha_sweet_bg_hj.mp4
File Size : 537.04 MB
Resolution : 1920x1080
Duration : 00:06:12

Download K2S VIDEO:
Keep2Share Video: cd_s562_alina_long_sasha_sweet_bg_hj.mp4 (https://k2s.cc/file/133ca7e6e199e)

Clit
02-05-2025, 01:57 AM
Clubdom.com- Rikki Rumor & Jade Whipping
https://img119.imagetwist.com/th/67140/y9q8tq53a5mm.jpg (https://imagetwist.com/y9q8tq53a5mm/MjbSAQ.jpg)
https://img202.imagetwist.com/th/67140/2mailaky8log.jpg (https://imagetwist.com/2mailaky8log/ylYNXIPK.jpg)

Description:
Rikki Rumor & Jade Whipping
Model:
Jade Jantzen, Rikki Rumor
Studio:
Clubdom.com
Info:
File Name : cd_s935_rikkirumor_jadejantzen_whipping.mp4
File Size : 717.34 MB
Resolution : 1920x1080
Duration : 00:08:20

Download K2S VIDEO:
Keep2Share Video: cd_s935_rikkirumor_jadejantzen_whipping.mp4 (https://k2s.cc/file/df11192928ecf)

Clit
02-05-2025, 01:59 AM
Clubdom.com- They Own Your Balls
https://s10.imagetwist.com/th/67147/fz116a4s5tsu.jpg (https://imagetwist.com/fz116a4s5tsu/aBuGNdTi.jpg)
https://img69.imagetwist.com/th/67147/vzby9xeaoc2t.jpg (https://imagetwist.com/vzby9xeaoc2t/KgNdjawZ.jpg)

Description:
Goddess Alexis Grace and Mistress Dahlia Rain are giddy and smiling with their hands wrapped around their slave_s balls, squeezing them tightly. They are so happy because they know they are about to administer extreme pain to these pathetic balls that they own, and there is nothing this helpless owned slave can do about it The Mistresses take turns squeezing and poking with their fingernails into his exposed, delicate prunes. That is just the beginning. The Mistresses line up the slave and take turns bashing his balls in with their swift and fierce kicks He can feel that pain shooting through his stomach, crippling him. Again and again, he must endure the torment until the women decide they are finished.
Model:
Alexis Grace, Dahlia Rain
Studio:
Clubdom.com
Info:
File Name : cd_s1015_dahilarain_alexisgrace_ballbusting.mp4
File Size : 669.09 MB
Resolution : 1920x1080
Duration : 00:07:45

Download K2S VIDEO:
Keep2Share Video: cd_s1015_dahilarain_alexisgrace_ballbusting.mp4 (https://k2s.cc/file/62e3d3cedc422)

Clit
02-05-2025, 02:05 AM
Clubdom.com- Goddess Alexia Jordon_s Boot Faggot
https://img166.imagetwist.com/th/67168/zdzx8l5nnnmp.jpg (https://imagetwist.com/zdzx8l5nnnmp/fCbDTjN.jpg)
https://s10.imagetwist.com/th/67169/x06xn88n82jd.jpg (https://imagetwist.com/x06xn88n82jd/gFrdtjO.jpg)

Description:
Goddess Alexia Jordon has her slave on his knees because the little bitch boy has graduated to boot faggot. Mistress is wearing tall shiny black boots and they need to be fully cleaned. The boot faggot gets to work. The boot faggot starts with her heel and Goddess Alexia makes him suck on it. She knows he likes sucking on that heel like he likes to suck big black cock. The eager Boot faggot agrees with what ever his boot Goddess says. Alexia makes sure he knows that he is nothing more then a pathetic boot slave.
Model:
Alexia Jordon
Studio:
Clubdom.com
Info:
File Name : cd_s532_alexia_jordan_boot_worship.mp4
File Size : 586.43 MB
Resolution : 1920x1080
Duration : 00:06:51

Download K2S VIDEO:
Keep2Share Video: cd_s532_alexia_jordan_boot_worship.mp4 (https://k2s.cc/file/0c9abb2f83c5b)

Clit
02-05-2025, 02:16 AM
Clubdom.com- Routine Monday Beatings
https://s10.imagetwist.com/th/67139/f06prgffsztd.jpg (https://imagetwist.com/f06prgffsztd/ADpWrPDz.jpg)
https://img401.imagetwist.com/th/67139/d8jjo8djcz9w.jpg (https://imagetwist.com/d8jjo8djcz9w/aGlLDfs.jpg)

Description:
The three sadistic Mistresses walk into the patio, their high heels click loudly on the bricks. The slave is bent over a spanking bench and can hear them coming. He knows they mean business. They Mistresses aim to break each and every slave here at clubdom and they do it by giving them routine beatings until the men are nothing but obedient piles of mush. Jean Bardot holds slave 019 down while Lydia and Lynn take turns delivering vicious swats with their paddle and leather strap. Eventually it_s Jeans turn and she straps him swiftly and viciously, sending searing pain across his backside. He can feel every horrible hit and hear the noise it makes as the implements beat into his ass. Loudest of all, he hears the women taunting him.
Model:
Jean Bardot, Lydia Supremacy
Studio:
Clubdom.com
Info:
File Name : cd_s962_lynnpops_jeanbartdot_lydiasupremacy_strapp ingpaddlingbart.mp4
File Size : 555.54 MB
Resolution : 1920x1080
Duration : 00:06:30

Download K2S VIDEO:
Keep2Share Video: cd_s962_lynnpops_jeanbartdot_lydiasupremacy_strapp ingpaddlingbart.mp4 (https://k2s.cc/file/1dc8a714b5bc7)

Clit
02-05-2025, 02:17 AM
Clubdom.com- Dava Foxx Gets Pleasured by Chindo
https://img69.imagetwist.com/th/67128/25w48s051mci.jpg (https://imagetwist.com/25w48s051mci/qZQtgY.jpg)
https://img34.imagetwist.com/th/67128/xd6w1yn42jg2.jpg (https://imagetwist.com/xd6w1yn42jg2/GiIElPcW.jpg)

Description:
Goddess Dava Foxx has her slave on his knees lubing up her hard 14 inch cock getting it ready to shove up your ass, she knows what an anal whore you are and plans on giving you the pounding of your pathetic slutty life, She goes deep and hard fuck you till she gets off, Then kicks you in the ass all the way back to the stable.
Model:
Dava Foxx
Studio:
Clubdom.com
Info:
File Name : s860davafoxxchindo.mp4
File Size : 638.46 MB
Resolution : 1920x1080
Duration : 00:07:23

Download K2S VIDEO:
Keep2Share Video: s860davafoxxchindo.mp4 (https://k2s.cc/file/9c67de1c9f332)

Clit
02-05-2025, 02:19 AM
Clubdom.com- Natalia & Paris Foot Worship
https://s10.imagetwist.com/th/67129/po657our82ss.jpg (https://imagetwist.com/po657our82ss/UDPpucf.jpg)
https://img202.imagetwist.com/th/67129/ivfx7l7c7obo.jpg (https://imagetwist.com/ivfx7l7c7obo/pmAKAcy.jpg)

Description:
Goddesses Natalia and Paris enjoy sunbathing while drpgd in their furs, their slave worshiping their feet as they relax. When their bitch does not show enough enthusiasm, they spank his ass to give him even more incentive.
Model:
Natalia Starr, Paris Knight
Studio:
Clubdom.com
Info:
File Name : s911nataliaparismichellelacyfootworship.mp4
File Size : 399.79 MB
Resolution : 1920x1080
Duration : 00:04:44

Download K2S VIDEO:
Keep2Share Video: s911nataliaparismichellelacyfootworship.mp4 (https://k2s.cc/file/9f211b232d622)

Clit
02-05-2025, 02:28 AM
Clubdom.com- How Sadists Get Off
https://img34.imagetwist.com/th/67154/sl4q78skj9hd.jpg (https://imagetwist.com/sl4q78skj9hd/HEMtnx.jpg)
https://img69.imagetwist.com/th/67155/e5j48cxx9fdo.jpg (https://imagetwist.com/e5j48cxx9fdo/BflGNJBn.jpg)

Description:
Goddess Harlow is in a very horny mood and she wants to get off. Dahlia has chosen a slave to be the lucky object of Harlow_s sadistic enjoyment. Harlow grabs her slave and drags him over towards her and uses his dildo-gag to pleasure her pussy while she watches Goddess Dahlia put on a display of sadism like Harlow has never seen before. The more shredded his back becomes and the louder he screams, the harder her dildo-gagged slave must fuck her.
Model:
Dahlia Rain
Studio:
Clubdom.com
Info:
File Name : cd_s1062_dahliaharlow_whipchindo.mp4
File Size : 617.59 MB
Resolution : 1920x1080
Duration : 00:07:09

Download K2S VIDEO:
Keep2Share Video: cd_s1062_dahliaharlow_whipchindo.mp4 (https://k2s.cc/file/a4192c5c46995)

Clit
02-05-2025, 02:33 AM
Clubdom.com- Natalia, Paris, & Michelle- Two Whips for Two slaves
https://img202.imagetwist.com/th/67129/wptnh4lkgkfh.jpg (https://imagetwist.com/wptnh4lkgkfh/fSIxwhj.jpg)
https://img69.imagetwist.com/th/67129/cwu3mf3hfy4b.jpg (https://imagetwist.com/cwu3mf3hfy4b/XHenYxU.jpg)

Description:
Before selling her slave to Mistresses Natalia and Paris, Mistress Michelle Lacy gives him a goodbye whipping. As Michelle whips her sold slave and another unfortunate stable slave with two very merciless whips, she reminds her bitch that his new purpose in life will be to serve his new owners and make them happy. But she wants to give him some pain to remember her by first.
Model:
Michelle Lacy, Natalia Starr, Paris Knight
Studio:
Clubdom.com
Info:
File Name : s913nataliaparismichellelacywhipping.mp4
File Size : 398.19 MB
Resolution : 1920x1080
Duration : 00:04:37

Download K2S VIDEO:
Keep2Share Video: s913nataliaparismichellelacywhipping.mp4 (https://k2s.cc/file/16913078a38c9)

Clit
02-05-2025, 02:39 AM
Clubdom.com- Elena & Sabrina- Plowing Man Holes
https://s10.imagetwist.com/th/67142/nrquy16tcbdg.jpg (https://imagetwist.com/nrquy16tcbdg/KRVLtH.jpg)
https://img69.imagetwist.com/th/67142/xlwqhnfh4bo9.jpg (https://imagetwist.com/xlwqhnfh4bo9/bMwtJvr.jpg)

Description:
The two lesbian lovers are back to destroy man holes with their cocks, all to get their pussies wet from watching the men squirm. They will ass-fuck as many men as it takes in order to get wet and turned on. Watch as they get pleasure from fucking men good and hard, like they should be.
Model:
Elena Koshka, Sabrina Paige
Studio:
Clubdom.com
Info:
File Name : cd_s981_elenakoshka_sabrinapaige_strapon2.mp4
File Size : 593.9 MB
Resolution : 1920x1080
Duration : 00:06:54

Download K2S VIDEO:
Keep2Share Video: cd_s981_elenakoshka_sabrinapaige_strapon2.mp4 (https://k2s.cc/file/a1cfdc560910e)

Clit
02-05-2025, 02:42 AM
Clubdom.com- Boot Sluts Jerk Off (POV)
https://img401.imagetwist.com/th/67127/m5g51f3f5clf.jpg (https://imagetwist.com/m5g51f3f5clf/otrcJCH.jpg)
https://img119.imagetwist.com/th/67127/k4a8ozkyt9kj.jpg (https://imagetwist.com/k4a8ozkyt9kj/EbxKMncn.jpg)

Description:
Mistress Michelle Lacy and Goddess Alexis Fawx know what a drooling little boot slut you are and tease you with their sexy thigh high black boots telling you how they know you wish you could lick and suck on them as you imagine them shoving the high heel down your throat wishing it was a huge black cock then they count you down letting you jerk that pathetic slut stick and slurp up your own filth boot bitch.
Model:
Alexis Fawx, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s870alexisfawxmechellelacypov2.mp4
File Size : 557.25 MB
Resolution : 1920x1080
Duration : 00:06:25

Download K2S VIDEO:
Keep2Share Video: s870alexisfawxmechellelacypov2.mp4 (https://k2s.cc/file/940769eedd564)

Clit
02-05-2025, 02:43 AM
Clubdom.com- Slave to Please
https://img401.imagetwist.com/th/67166/iakxt5vhdehx.jpg (https://imagetwist.com/iakxt5vhdehx/GcoILtHR.jpg)
https://s10.imagetwist.com/th/67166/c1b6e9c8by4y.jpg (https://imagetwist.com/c1b6e9c8by4y/UkmVrfkm.jpg)

Description:
Alexia Jordon and Kimmy Lee know full well what male bitches are for, Alexia Jordon has the bitch_s balls strapped with an electronic shocker. Kimmy has the bitch filled with a dildo gag. The male slut is ordered to pleasure Kimmy as Alexia shocks his balls. Kimmy grabs the slut by the back of his head and demands that demands that he pleasures her until her pussy juices are running down this throat. Alexia laughs and keeps right on torturing the slut_s balls.
Model:
Alexia Jordon, Kimmylee
Studio:
Clubdom.com
Info:
File Name : cd_s530_kimmy_lee_alexia_jordan_chindo.mp4
File Size : 499.97 MB
Resolution : 1920x1080
Duration : 00:05:48

Download K2S VIDEO:
Keep2Share Video: cd_s530_kimmy_lee_alexia_jordan_chindo.mp4 (https://k2s.cc/file/76ccf579c08d9)

Clit
02-05-2025, 02:50 AM
Clubdom.com- Kimmy Lee & Alexia Jordan Fucking Boots Worship
https://s10.imagetwist.com/th/67162/l0wdfq07nxci.jpg (https://imagetwist.com/l0wdfq07nxci/XHzeNh.jpg)
https://img119.imagetwist.com/th/67162/jdre589nvzdn.jpg (https://imagetwist.com/jdre589nvzdn/CnTkjrK.jpg)

Description:
Training of Alexia Jordon and Kimmy Lee_s Boot Bitch slut, shocking the slut with a cattle prod as he is ordered to lick the dirt from the bottom of Alexia_s heels. Then the bitch is ordered to show the ladies what a boot whore he is by having sex with Alexia_s thigh high boots. When the slut is made to spill his filth all over Alexia_s patent and leather boots, he is ordered to lick up every drop
Model:
Alexia Jordon, Kimmylee
Studio:
Clubdom.com
Info:
File Name : cd_s529_kimmy_lee_alexia_jordan_caddle_prod_fuck_b oots_slave.mp4
File Size : 598.03 MB
Resolution : 1920x1080
Duration : 00:06:56

Download K2S VIDEO:
Keep2Share Video: cd_s529_kimmy_lee_alexia_jordan_caddle_prod_fuck_b oots_slave.mp4 (https://k2s.cc/file/53bfc5b574c5b)

Clit
02-05-2025, 02:51 AM
Clubdom.com- Esmi_s Halloween 2- Pussy Serv
https://img166.imagetwist.com/th/67152/gp6xs6rpqojx.jpg (https://imagetwist.com/gp6xs6rpqojx/omZBmytY.jpg)
https://img69.imagetwist.com/th/67152/34vd4dse3suv.jpg (https://imagetwist.com/34vd4dse3suv/dzuWFOG.jpg)

Description:
Esmi has her enslaved pleasure pets doing everything she says. She slaps one of them across the face and makes him lick and eat her pussy while the other slave watches. When he isn_t making her cum, Esmi makes the other slave pleasure her with a dildo gag.
Model:
Esmi Lee
Studio:
Clubdom.com
Info:
File Name : cd_s1065_2-2_esmilee_chindohw.mp4
File Size : 599.27 MB
Resolution : 1920x1080
Duration : 00:06:57

Download K2S VIDEO:
Keep2Share Video: cd_s1065_2-2_esmilee_chindohw.mp4 (https://k2s.cc/file/b667ea3b8f125)

Clit
02-05-2025, 02:53 AM
Clubdom.com- Strap-on Contest for the She-Gods
https://img119.imagetwist.com/th/67135/fdvjtbvk04ds.jpg (https://imagetwist.com/fdvjtbvk04ds/vvCbOYHR.jpg)
https://img401.imagetwist.com/th/67136/1nbs9sxkpw4i.jpg (https://imagetwist.com/1nbs9sxkpw4i/WDHWWKf.jpg)

Description:
Michelle Lacy is having a fantastic time showing Goddess Tangent and Natasha around the estate, using males for their pleasure. The girls decide they are going to come up with a little game since there are 3 slaves handy and 3 Women. They will all strap-on fuck the slaves until the slaves cannot handle it anymore. Whichever slave begs for mercy or collapses first, is the LOSER He will be the one who is punished, perhaps thrown into the huge slave pit. The girls relentlessly fuck each slave as the men take their brutal assault on their asses, shackled down and unable are unable to escape or do anything except take it and hope it will be over as soon as possible. Unfortunately, the women are going to fuck them so hard with their goal in mind to get one of them to give up. The girls will try anything to get one of the slaves to give up face-slapping, giant dildos, and even spit-roasting both the holes of one slave. They will have their fun at the expense of the poor crying slaves.
Model:
Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s940michellelacygoddesstangenttriplestrapon.mp4
File Size : 970.07 MB
Resolution : 1920x1080
Duration : 00:09:33

Download K2S VIDEO:
Keep2Share Video: s940michellelacygoddesstangenttriplestrapon.mp4 (https://k2s.cc/file/ecc8a5e881c6a)

Clit
02-05-2025, 02:58 AM
Clubdom.com- Caught By the Guardesses Part 4- Fucking the Intruder
https://s10.imagetwist.com/th/67138/kojwddgvmth2.jpg (https://imagetwist.com/kojwddgvmth2/bTKOSAV.jpg)
https://img166.imagetwist.com/th/67138/cxicnyqaa3rv.jpg (https://imagetwist.com/cxicnyqaa3rv/WAIwcDU.jpg)

Description:
The Guardesses Paris and Jamie come back into the dungeon with their new pet man to train him to be their strap-on bitch. He must suck their cocks good and lube them up with his deep-throat spit because that is the only lube these sadistic women are going to offer him After they are pleased with his sucking, he is bent over and forced to take Paris_s huge femdom cock while Jamie taunts him and shoves her huge black cock in his mouth, both girls laughing at his predicament, knowing he must feel so powerless as he is stuffed by their powerful cocks from both ends.
Model:
Jamie Valentine
Studio:
Clubdom.com
Info:
File Name : cd_s955_4-4_jamievalentine_paris_straponintruder.mp4
File Size : 558.79 MB
Resolution : 1920x1080
Duration : 00:06:29

Download K2S VIDEO:
Keep2Share Video: cd_s955_4-4_jamievalentine_paris_straponintruder.mp4 (https://k2s.cc/file/ec30e5e89f051)

Clit
02-05-2025, 03:11 AM
Clubdom.com- You_re Just a Fuck-Hole
https://img69.imagetwist.com/th/67151/l5sd8ys0emmn.jpg (https://imagetwist.com/l5sd8ys0emmn/xTkBJcKW.jpg)
https://img69.imagetwist.com/th/67152/7fhjesyr3bp7.jpg (https://imagetwist.com/7fhjesyr3bp7/QkBUljIb.jpg)

Description:
Harlow and Dahlia are gorgeous Goddesses who tower over you as you kneel before them, ready to do whatever they say. These women are almost naked and you feel powerless and weak staring up at their naked heavenly bodies. The woman know that you will do everything they say, and they love every minute of it. They want you to spread your ass cheeks and open up your slut-hole for them, and start shoving things inside of your slut-hole while the women watch. You will train yourself for them, because they have plans of using that fuck-hole of theirs whenever they feel like it.
Model:
Dahlia Rain, Harlow Harrison
Studio:
Clubdom.com
Info:
File Name : cd_s1058_dahliaharlow_pov2.mp4
File Size : 447.43 MB
Resolution : 1920x1080
Duration : 00:05:11

Download K2S VIDEO:
Keep2Share Video: cd_s1058_dahliaharlow_pov2.mp4 (https://k2s.cc/file/e8e928b59633d)

Clit
02-05-2025, 03:13 AM
Clubdom.com- Ruined Orgasm Milking While Tiedup
https://img34.imagetwist.com/th/67131/afas55lcqx4k.jpg (https://imagetwist.com/afas55lcqx4k/oEDfeF.jpg)
https://s10.imagetwist.com/th/67131/y9ninx0zg0q7.jpg (https://imagetwist.com/y9ninx0zg0q7/ZneOyJt.jpg)

Description:
ClubDom, In Our World Women Rule. Mistress Cheyenne has got her slave by the balls and isn_t going to let him off easy It_s ball busting time In Our World ..
Model:
Cherry Morgan, Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : forcedruinedorgasm.mp4
File Size : 142.12 MB
Resolution : 854x480
Duration : 00:05:25

Download K2S VIDEO:
Keep2Share Video: forcedruinedorgasm.mp4 (https://k2s.cc/file/639fc0a310d06)

Clit
02-05-2025, 03:14 AM
Clubdom.com- Harlow Harrison Boot Worship
https://img202.imagetwist.com/th/67160/uls1lisfnulm.jpg (https://imagetwist.com/uls1lisfnulm/oBJWGXQ.jpg)
https://img69.imagetwist.com/th/67160/7h490zgrn1x7.jpg (https://imagetwist.com/7h490zgrn1x7/oDrBjN.jpg)

Description:
Goddess Harlow Harrison loves wearing her thigh high latex boots. Her pathetic slave can only get hard when he fucks her boots. Goddess Harlow makes her slave worship her shiny boots with his tongue. After he licks her boots up and down, her jerks off his slut stick all over Goddess Harlow_s boots which she forces him to clean up with his mouth.
Model:
Harlow Harrison
Studio:
Clubdom.com
Info:
File Name : cd_s1105_harlowharrison_boot.mp4
File Size : 565.35 MB
Resolution : 1920x1080
Duration : 00:06:34

Download K2S VIDEO:
Keep2Share Video: cd_s1105_harlowharrison_boot.mp4 (https://k2s.cc/file/924567d384f6d)

Clit
02-05-2025, 03:31 AM
Clubdom.com- Mistress Michelle- Runaway slave_s First Whipping
https://img69.imagetwist.com/th/67134/xuvkqb1fhfy3.jpg (https://imagetwist.com/xuvkqb1fhfy3/mQBOlGI.jpg)
https://img69.imagetwist.com/th/67134/6x0e2vojcvm2.jpg (https://imagetwist.com/6x0e2vojcvm2/krMxsOz.jpg)

Description:
Mistress Michelle Lacy, keeper of the slaves has found the newest slave has escaped. She drags him back to the estate and has him shackled and awaiting his punishment. She shows him to Goddess Tangent who agrees that he needs to be strung-up and whipped.....upside-down The two Superstar Goddesses of femdom rip into him with their whips while they laugh and taunt him as he cries out apologies. He has never been whipped before and this is a punishment he will never forget. There is nothing like the sting of a whip, especially your first. The ladies mercilessly shred his back and show him that here, femdom is the ONLY WAY and there is absolutely no escape. If he knew how bad it would hurt, he might have never ran. Too late now...
Model:
Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s939michellelacygoddesstangentsuspensionwhip.mp4
File Size : 749.25 MB
Resolution : 1920x1080
Duration : 00:07:28

Download K2S VIDEO:
Keep2Share Video: s939michellelacygoddesstangentsuspensionwhip.mp4 (https://k2s.cc/file/9dee1359afa8e)

Clit
02-05-2025, 03:31 AM
Clubdom.com- Nadia & Goddess Valora_s Chindo Plaything
https://img69.imagetwist.com/th/67158/qb0ct3j31apf.jpg (https://imagetwist.com/qb0ct3j31apf/uwZVHIV.jpg)
https://img119.imagetwist.com/th/67158/n9ie337tb151.jpg (https://imagetwist.com/n9ie337tb151/bstQXZR.jpg)

Description:
Goddess Valora learns that one of her slaves wants to experience the pleasure of fucking blonde Goddess Nadia White. Instead of using his pathetic filthy cock, they put a chindo on his face so that Goddess Nadia has a chance to get a bit of pleasure. Goddess Valora pushes the slave_s head towards Goddess Nadia_s pussy so the slave can learn what fucking feels like.
Model:
Goddess Valora, Nadia White
Studio:
Clubdom.com
Info:
File Name : cd_s1078_nadiawhite_goddessvalora_chindo.mp4
File Size : 493.38 MB
Resolution : 1920x1080
Duration : 00:05:42

Download K2S VIDEO:
Keep2Share Video: cd_s1078_nadiawhite_goddessvalora_chindo.mp4 (https://k2s.cc/file/65aa81c9255e4)

Clit
02-05-2025, 03:34 AM
Clubdom.com- Nikki Brooks Caning a Helpless Man
https://img119.imagetwist.com/th/67156/r1d9cky0h5kw.jpg (https://imagetwist.com/r1d9cky0h5kw/EusAWpz.jpg)
https://img202.imagetwist.com/th/67156/e84i0wqs7d36.jpg (https://imagetwist.com/e84i0wqs7d36/LgXNbcqU.jpg)

Description:
ClubDom, In Our World Women Rule. Mistress Cheyenne has got her slave by the balls and isn_t going to let him off easy It_s ball busting time In Our World ..
Model:
Nikki Brooks
Studio:
Clubdom.com
Info:
File Name : cd_s1070_nikkibrooks_caning.mp4
File Size : 545.7 MB
Resolution : 1920x1080
Duration : 00:06:20

Download K2S VIDEO:
Keep2Share Video: cd_s1070_nikkibrooks_caning.mp4 (https://k2s.cc/file/edef9c0f79713)

Clit
02-05-2025, 03:39 AM
Clubdom.com- Michelle_s Pleasure Slave 3- Whipped
https://img401.imagetwist.com/th/67146/1yuu5we0og21.jpg (https://imagetwist.com/1yuu5we0og21/IwAOvTgw.jpg)
https://img119.imagetwist.com/th/67146/fibuugfsip3q.jpg (https://imagetwist.com/fibuugfsip3q/qLjbTx.jpg)

Description:
Michelle is now going to whip her slave for failing to pleasure her. She already bruised up his cock and not she wants to do the same to his back. Michelle whips her slave while threatening him. If I wasn_t thinking about using you as a human dildo later, I might have taken all of your skin off she says about his cock. Michelle makes the slave suffer with each lash. Then she admires his lashes and with her leather gloved hand, makes him taste her wet pussy.
Model:
Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : cd_s1012_3-6_michellelacy_whipping.mp4
File Size : 471.1 MB
Resolution : 1920x1080
Duration : 00:05:27

Download K2S VIDEO:
Keep2Share Video: cd_s1012_3-6_michellelacy_whipping.mp4 (https://k2s.cc/file/9a3d3012babb6)

Clit
02-05-2025, 04:13 AM
Clubdom.com- Madame Nikki_s Demanding Slut
https://s10.imagetwist.com/th/67157/77gvf6ja79bm.jpg (https://imagetwist.com/77gvf6ja79bm/jVFVqc.jpg)
https://s10.imagetwist.com/th/67157/28gor3d4auf6.jpg (https://imagetwist.com/28gor3d4auf6/JbgEzfRo.jpg)

Description:
Goddess Nikki Brooks needs to punish her maid slave for not doing his job well enough. She has him bent over and screaming as she fills his tight man pussy with her strap on cock. Maybe next time her slave will learn how to clean. If not, Goddess Nikki will be happy to teach him another lesson.
Model:
Nikki Brooks
Studio:
Clubdom.com
Info:
File Name : cd_s1074_nikkibrooks_strapon.mp4
File Size : 417.83 MB
Resolution : 1920x1080
Duration : 00:04:52

Download K2S VIDEO:
Keep2Share Video: cd_s1074_nikkibrooks_strapon.mp4 (https://k2s.cc/file/8f0f1bdf3003e)

Clit
02-05-2025, 04:40 AM
Clubdom.com- Michelle, Tangent & Rikki- Smothered and Milked
https://img119.imagetwist.com/th/67136/snrqu5agscg8.jpg (https://imagetwist.com/snrqu5agscg8/BUGYoU.jpg)
https://img119.imagetwist.com/th/67136/zpwkp2igqgsr.jpg (https://imagetwist.com/zpwkp2igqgsr/dOdUEO.jpg)

Description:
Mistress Ricky is stroking the slave_s hard cock. He must be so lucky to be out of chastity, except he knows his permission to cum will come at a price. The Mistresses are cruel and won_t ever let any slave have pleasure unless their sadistic torments follow. Mistress Michelle Lacy and Goddess Tangent provoke the slave and tease and smother him with their leather gloved hands and arms until his breath is taken away over and over again. The slave finally cums, but Mistress Ricky feeds it to him. She is learning how to be a cruel Mistress after all here at Clubdom.
Model:
Goddess Tangent, Michelle Lacy, Rikki Rumor
Studio:
Clubdom.com
Info:
File Name : s943michelletangentrikkirumorhandjob.mp4
File Size : 907.58 MB
Resolution : 1920x1080
Duration : 00:09:01

Download K2S VIDEO:
Keep2Share Video: s943michelletangentrikkirumorhandjob.mp4 (https://k2s.cc/file/700db6b6f3243)

Clit
02-05-2025, 05:05 AM
Clubdom.com- Pool Boys Balls get Busted
https://img166.imagetwist.com/th/67165/if1h2d5ebcc0.jpg (https://imagetwist.com/if1h2d5ebcc0/QwhDJgoL.jpg)
https://img69.imagetwist.com/th/67165/p40d70lbbfmb.jpg (https://imagetwist.com/p40d70lbbfmb/JEBeDwj.jpg)

Description:
The pool boy is at the estate cleaning the pool. As the mistresses walk past they hear him make an inappropriate comment about what nice asses they have. Snide remarks like that deserve a lesson. Amadahy quickly pulls his pants down and grabs his balls showing him she_s in control and that she owns him. Cheyenne Jewel then flips him up around her shoulders and carries him out to the field. Cheyenne holds him steady as Amadahy proceeds to jump kick him right in the nuts. Ball busting at its best Over and over, kick after kick, she wins as he stumbles to the ground. With victory they sit on top of him and scoop up his pathetic slut sacks as a reminder of who owns men
Model:
Cheyenne Jewel, Goddess Amadahy
Studio:
Clubdom.com
Info:
File Name : cd_s506_cheyenne_jewel_amadahy_bb_lift_carry.mp4
File Size : 447.92 MB
Resolution : 1920x1080
Duration : 00:05:15

Download K2S VIDEO:
Keep2Share Video: cd_s506_cheyenne_jewel_amadahy_bb_lift_carry.mp4 (https://k2s.cc/file/903c4789d8589)

Clit
02-05-2025, 05:21 AM
Clubdom.com- Elena & Sabrina- Fuck-Meat for Mistresses
https://img69.imagetwist.com/th/67141/00p9utamk4t4.jpg (https://imagetwist.com/00p9utamk4t4/fMEaqtS.jpg)
https://img202.imagetwist.com/th/67141/ron5fcgtkza8.jpg (https://imagetwist.com/ron5fcgtkza8/upHyWSRf.jpg)

Description:
Elena and Sabrina are ready to fuck pathetic slave asses. They stroke their cocks and taunt their slave and then begin to fuck harder and harder for each other_s sadistic entertainment. The women are so turned on by fucking moaning slaves that they cannot keep their hands off of each other. Its the slaves who must suffer for their amusement and sexual enjoyment.
Model:
Elena Koshka, Sabrina Paige
Studio:
Clubdom.com
Info:
File Name : cd_s980_elenakoshka_sabrinapaige_strapon.mp4
File Size : 633.87 MB
Resolution : 1920x1080
Duration : 00:07:19

Download K2S VIDEO:
Keep2Share Video: cd_s980_elenakoshka_sabrinapaige_strapon.mp4 (https://k2s.cc/file/efb69da4e3944)

Clit
02-05-2025, 05:24 AM
Clubdom.com- Punished with BallBusting
https://img166.imagetwist.com/th/67150/duiygq32n7h2.jpg (https://imagetwist.com/duiygq32n7h2/qctJTj.jpg)
https://img119.imagetwist.com/th/67150/1xs54n6tx934.jpg (https://imagetwist.com/1xs54n6tx934/vaxIHL.jpg)

Description:
Mistress Dahlia and Goddess Harlow know their slave is in serious trouble as they find him hiding in the bushes. How dare he laugh at another slave_s fortune for losing the pony cart race. Does he not know that he is no better than the losing slave? Now he will learn just how worthless he really is. Dahlia and Harlow take turns unleashing cruel kicks to their slave_s sensitive balls, sending crippling pain throughout his stomach and taunting him. There is no rule-breaking here at Clubdom and this slave will learn.
Model:
Dahlia Rain, Harlow Harrison
Studio:
Clubdom.com
Info:
File Name : cd_s1051_dahliaharlow_ballbusting.mp4
File Size : 669.8 MB
Resolution : 1920x1080
Duration : 00:07:48

Download K2S VIDEO:
Keep2Share Video: cd_s1051_dahliaharlow_ballbusting.mp4 (https://k2s.cc/file/6fe09eec292b7)

Clit
02-05-2025, 05:24 AM
Clubdom.com- Esmi Lee & Isobel Devi Fuck With Strap Ons
https://img202.imagetwist.com/th/67151/zc2gyx939tz6.jpg (https://imagetwist.com/zc2gyx939tz6/ftKqxVQy.jpg)
https://img34.imagetwist.com/th/67151/5de8113v8kf7.jpg (https://imagetwist.com/5de8113v8kf7/CkuTTxL.jpg)

Description:
Goddesses Esmi Lee and Isobel Devi are ready to break in their new pathetic slaves. They pull them out of their cage and force them to lube up their big black strap on cocks with their tight mouths. After their slaves get their black cocks lubed up with spit, they bend their new slaves over and fuck their virgin asses. The Goddesses stuff their slave_s man pussies deep and hard before sending them off screaming into the night.
Model:
Esmi Lee, Isobel Devi
Studio:
Clubdom.com
Info:
File Name : cd_s1064_2-2_esmilee_isobeldevi_strapon.mp4
File Size : 722.39 MB
Resolution : 1920x1080
Duration : 00:08:24

Download K2S VIDEO:
Keep2Share Video: cd_s1064_2-2_esmilee_isobeldevi_strapon.mp4 (https://k2s.cc/file/fba7c55a7be30)

Clit
02-05-2025, 05:34 AM
Clubdom.com- Caught Byt the Guardesses Part 3- Fuck Toy
https://img401.imagetwist.com/th/67137/suwgra35ej0y.jpg (https://imagetwist.com/suwgra35ej0y/tlgMWev.jpg)
https://img166.imagetwist.com/th/67138/h2fimhifqw9f.jpg (https://imagetwist.com/h2fimhifqw9f/QtOQzYjx.jpg)

Description:
The Guardesses actually do not need any information out of their spy as they were already informed of everything they need to know. they decide due to the size of his cock, they will keep him around and use him for sex. He must pleasure them or else. Paris decides she wants a ride and tests out their new slave_s cock. He must make her cum or Jamie will most likely take his balls.
Model:
Jamie Valentine, Paris Knight
Studio:
Clubdom.com
Info:
File Name : cd_s955_3-4_jamievalentine_paris_boygirl.mp4
File Size : 529.58 MB
Resolution : 1920x1080
Duration : 00:06:09

Download K2S VIDEO:
Keep2Share Video: cd_s955_3-4_jamievalentine_paris_boygirl.mp4 (https://k2s.cc/file/ce3b4afa317cc)

Clit
02-05-2025, 05:44 AM
Clubdom.com- Arena Rome Dominates
https://img202.imagetwist.com/th/67169/ni418tazu3u2.jpg (https://imagetwist.com/ni418tazu3u2/XPrFUH.jpg)
https://img34.imagetwist.com/th/67169/jd9ot1ymnlve.jpg (https://imagetwist.com/jd9ot1ymnlve/BRXChjFV.jpg)

Description:
Queen Arena Rome drags her slave into her dungeon and forces his legs apart. She then gets a running start to kick him in his useless slut sacks. Queen Arena drags her slave around and uses her hands and feet to bust his fucking balls. Queen Arena Rome has her slave on her St. Andrew_s Cross and forces him to beg to be whipped. When Queen Arena is convinced her slave wants to feel the sting of her whip, she proceeds to lash his pale white back. Her slave cries out in pain while being whipped until his back is bright red. Queen Arena Rome has her pathetic slave bent over his cage and ready to get caned. Queen Arena makes him count the number of times his bare ass has been caned while she punishes her slave. Queen Arena Rome has been having fun punishing her slave, and is craving some pussy attention. Of course her pathetic slave will never be able to satisfy her, or even touch her wet pussy. Queen Arena makes her slave wear a chindo to fuck her with. She grabs the back of his head to help him fuck her pussy. Queen Arena Rome makes her slave lube up her strap on before she fucks his tight man pussy. When her big black cock is lubed up enough, Queen Arena bends her slave over and shoves her cock in his ass.
Model:
Arena Rome
Studio:
Clubdom.com
Info:
File Name : cd_s1110_full_arenarome_minimovie.mp4
File Size : 2833.31 MB
Resolution : 1920x1080
Duration : 00:32:43

Download K2S VIDEO:
Keep2Share Video: cd_s1110_full_arenarome_minimovie.mp4 (https://k2s.cc/file/a0a65cb1c2b7b)

Clit
02-05-2025, 05:47 AM
Clubdom.com- Qandisa & Amadhy Dick Fucking
https://img119.imagetwist.com/th/67149/rfdf9bt8loa6.jpg (https://imagetwist.com/rfdf9bt8loa6/ZZBcgB.jpg)
https://img34.imagetwist.com/th/67149/km6ayavnbf1p.jpg (https://imagetwist.com/km6ayavnbf1p/qWfSSNE.jpg)

Description:
The only pleasure this slave is going to have is the pleasure of servitude. If he is to have any other pleasure, it is IF and WHEN his owners allow it Amadahy fucks his dick with a urethral sounding rod while keeping him constantly on edge, while Queen Qandisa holds him down. Goddess Amadahy loves how close he is getting and she makes it more difficult for him to cum by inserting a larger urethral sound, stretching his hole. She laughs with sadistic joy while he suffers for her. This slave is going to truly learn what it is to have no control over his body. Goddess Amadahy and Queen Qandisa are in total control of him now and they are the only ones who decide if and when he gets to eat, sleep, breathe and cum
Model:
Queen Qandisa
Studio:
Clubdom.com
Info:
File Name : cd_s1046_qandisa_amadahy_dickfucking.mp4
File Size : 563.25 MB
Resolution : 1920x1080
Duration : 00:06:32

Download K2S VIDEO:
Keep2Share Video: cd_s1046_qandisa_amadahy_dickfucking.mp4 (https://k2s.cc/file/81770bf2d2ae6)

Clit
02-05-2025, 05:49 AM
Clubdom.com- Michelle_s Pleasure Slave 2- Cropped and Punished
https://img401.imagetwist.com/th/67146/1p3jko6x9rst.jpg (https://imagetwist.com/1p3jko6x9rst/DrvQTg.jpg)
https://img401.imagetwist.com/th/67146/bvq1y5e3ulh1.jpg (https://imagetwist.com/bvq1y5e3ulh1/HohEQJz.jpg)

Description:
Michelle is unhappy that she was not pleasured well enough when she finally had given her slave the chance to prove himself. Now he is in for a punishment he will not soon forget. Michelle decides that she wants him to suffer and she will start by punishing his cock. Michelle crops her slave_s cock repeatedly and hard while scolding him and showing him that he could have had his chance to pleasure her and he blew it. She punishes and scolds him while he winces in pain, his cock getting more bruised by the second.
Model:
Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : cd_s1012_2-6_michellelacy_cbt.mp4
File Size : 500.16 MB
Resolution : 1920x1080
Duration : 00:05:48

Download K2S VIDEO:
Keep2Share Video: cd_s1012_2-6_michellelacy_cbt.mp4 (https://k2s.cc/file/6fe2687416b64)

Clit
02-05-2025, 06:02 AM
Clubdom.com- Dahlia Ass Torments & Whipping
https://img119.imagetwist.com/th/67159/t5ey12x5yo4r.jpg (https://imagetwist.com/t5ey12x5yo4r/swpJXMnT.jpg)
https://s10.imagetwist.com/th/67159/ow0jxa4trunk.jpg (https://imagetwist.com/ow0jxa4trunk/LtRkxQ.jpg)

Description:
Goddess Dahlia Rain is breaking in her new slave and starts teasing him by forcing him to worship her round ass and wet Goddess pussy so he knows what he_s missing out on. Goddess Dahlia then chains him up so she can whip his white skin bright red. Goddess Dahlia rewards the great work by her pathetic slave by allowing him a taste of her pussy from her fingers.
Model:
Dahlia Rain
Studio:
Clubdom.com
Info:
File Name : cd_s1090_2-3_dahliarain_lydiasupremacy_whipping.mp4
File Size : 574.55 MB
Resolution : 1920x1080
Duration : 00:06:42

Download K2S VIDEO:
Keep2Share Video: cd_s1090_2-3_dahliarain_lydiasupremacy_whipping.mp4 (https://k2s.cc/file/2f9d70a688461)

Clit
02-05-2025, 06:03 AM
Clubdom.com- Human Ashtray For Mistress Caning
https://s10.imagetwist.com/th/67128/tr8f984toayb.jpg (https://imagetwist.com/tr8f984toayb/tTnQJUA.jpg)
https://img202.imagetwist.com/th/67129/svxvzuxeq26j.jpg (https://imagetwist.com/svxvzuxeq26j/mKgNeDf.jpg)

Description:
This slave is in for real punishment with Lydia Supremacy, Michelle Lacy, Isobel Devi and Natalya Sadici all gang up on him and decide to take turns caning his pathetic ass. The women play a nice little game with the caning, and it is not for the faint of heart. This slave is truly suffering for the enjoyment of the women as they each take their turn destroying him.
Model:
Isobel Devi, Lydia Supremacy, Michelle Lacy, Natalya Sadici
Studio:
Clubdom.com
Info:
File Name : s893michellelacynatalyasadiciisobeldevilcaning.mp4
File Size : 1017.29 MB
Resolution : 1920x1080
Duration : 00:11:45

Download K2S VIDEO:
Keep2Share Video: s893michellelacynatalyasadiciisobeldevilcaning.mp4 (https://k2s.cc/file/770129bec3d44)

Clit
02-05-2025, 06:38 AM
Clubdom.com- Isobel Devi & Veronica Snow StrapOn
https://img34.imagetwist.com/th/67148/dnfs6oegsznf.jpg (https://imagetwist.com/dnfs6oegsznf/FVycEUy.jpg)
https://s10.imagetwist.com/th/67148/57z2kjay082v.jpg (https://imagetwist.com/57z2kjay082v/bFThKdz.jpg)

Description:
Isobel Devi and Veronica Snow know that they must cock-train their slaves early in order to keep them in line. By doing so, these men will know and always keep in mind who is the superior sex. The slaves, already weak, crawl into the room and wrap their mouths around Isobel and Veronica_s big strap-on cocks. Before long, the woman have them bent over with their huge cocks, struggling to go in and out of their slave_s tight virgin assholes. Its tough and painful but they have to be cock-trained and this is the only way. They must feel every single inch of these women_s cocks deep inside their manginas and know who rules them. This needs to be done every single day.
Model:
Isobel Devi, Veronica Snow
Studio:
Clubdom.com
Info:
File Name : cd_s1035_isobeldevi_veronicasnow_strapon.mp4
File Size : 480.82 MB
Resolution : 1920x1080
Duration : 00:05:35

Download K2S VIDEO:
Keep2Share Video: cd_s1035_isobeldevi_veronicasnow_strapon.mp4 (https://k2s.cc/file/23485f1910879)

Clit
02-05-2025, 06:40 AM
Clubdom.com- Arena Rome Hardcore Whiping
https://img401.imagetwist.com/th/67164/ye0qgnun3fpn.jpg (https://imagetwist.com/ye0qgnun3fpn/mzmGVPJ.jpg)
https://img119.imagetwist.com/th/67165/7ry198k4oop0.jpg (https://imagetwist.com/7ry198k4oop0/IjphoLFG.jpg)

Description:
Queen Arena Rome has her slave on her St. Andrew_s Cross and forces him to beg to be whipped. When Queen Arena is convinced her slave wants to feel the sting of her whip, she proceeds to lash his pale white back. Her slave cries out in pain while being whipped until his back is bright red.
Model:
Arena Rome
Studio:
Clubdom.com
Info:
File Name : cd_s1110_2-5_arenarome_whip.mp4
File Size : 684.78 MB
Resolution : 1920x1080
Duration : 00:07:57

Download K2S VIDEO:
Keep2Share Video: cd_s1110_2-5_arenarome_whip.mp4 (https://k2s.cc/file/56ee3e22c7c22)

Clit
02-05-2025, 06:40 AM
Clubdom.com- Megan Fucks Like She Fights
https://img34.imagetwist.com/th/67130/1ex76u6yyrq5.jpg (https://imagetwist.com/1ex76u6yyrq5/mRBXoFTx.jpg)
https://img119.imagetwist.com/th/67130/b9cnkerw4bgd.jpg (https://imagetwist.com/b9cnkerw4bgd/DrzbUw.jpg)

Description:
Megan Jones owns another ass today She can_t wait to show a loud mouth loser what a real champ is. Wrestling, kicking, and choking the sissy out. when Megan see_s he_s had enough, she pulls out the next part of his punishment. Her Strap on, which she will need lube for since she is going to fuck the loser. Kneel down and jerk your filth onto the big black cock, get it nice and wet because when it slide into that manpussy...it will be hard and rough. Megan fucks like she fights and sissy boys will be lining up outside the gym to bend over for her. Ding ding ding, Round one
Model:
Megan Jones
Studio:
Clubdom.com
Info:
File Name : cd_s04_meagan_fighting.mp4
File Size : 1617.81 MB
Resolution : 1920x1080
Duration : 00:18:39

Download K2S VIDEO:
Keep2Share Video: cd_s04_meagan_fighting.mp4 (https://k2s.cc/file/09e0296894a13)

Clit
02-05-2025, 06:50 AM
Clubdom.com- Lynn, Jean & Lydia StrapOn Fucking
https://img166.imagetwist.com/th/67139/aodm0rx5mv6g.jpg (https://imagetwist.com/aodm0rx5mv6g/sFsUZK.jpg)
https://img119.imagetwist.com/th/67139/h2zi7jenc8ib.jpg (https://imagetwist.com/h2zi7jenc8ib/ARkohp.jpg)

Description:
Lynn, Jean & Lydia StrapOn Fucking
Model:
Jean Bardot, Lydia Supremacy
Studio:
Clubdom.com
Info:
File Name : CD_S960_LynnPops_JeanBartdot_LydiaSupremacy_StrapO nAndrew.mp4
File Size : 807.1 MB
Resolution : 1920x1080
Duration : 00:05:20

Download K2S VIDEO:
Keep2Share Video: CD_S960_LynnPops_JeanBartdot_LydiaSupremacy_StrapO nAndrew.mp4 (https://k2s.cc/file/2e62a7d877e67)

Clit
02-05-2025, 06:54 AM
Clubdom.com- Michelle and Tangent_s Auction Slave 8- Duel Canings
https://img119.imagetwist.com/th/67145/xkku8sbqvk8u.jpg (https://imagetwist.com/xkku8sbqvk8u/FcjIqF.jpg)
https://img119.imagetwist.com/th/67145/9kd55bljtqce.jpg (https://imagetwist.com/9kd55bljtqce/vQfUCe.jpg)

Description:
The new auction slave and the seasoned Clubdom slave are bent over and restrained. They await their painful fate as Michelle Lacy and Goddess Tangent discuss how hard they are going to cane each man. Their auction slave is most likely going back to the slave farm but they want to cane him anyway. Perhaps he might show some glimmer of hope. The two Mistresses cane both slaves. With heavy lightening fast blows, the hits keep coming. The more the women hit them, the more sadistic and happy they become. The two men are definitely in intense pain but the auction slave just trembles and cries for mercy. These women are not having it. Back to the slave farm he goes but they need to punish the head slaver who sold him to them. Paris announces that he has arrived and the women grab him. Tangent face slaps him and kicks him in the balls while Michelle holds him. They scold the slaver and tell him he is to take back that pathetic excuse for a slave and to never sell them such a sorry excuse of a man ever again.
Model:
Goddess Tangent, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : cd_s992_8-8_michellelacy_goddesstangent_caning.mp4
File Size : 645.78 MB
Resolution : 1920x1080
Duration : 00:07:31

Download K2S VIDEO:
Keep2Share Video: cd_s992_8-8_michellelacy_goddesstangent_caning.mp4 (https://k2s.cc/file/15e5df49c66cc)

Clit
02-05-2025, 06:54 AM
Clubdom.com- Jewel & Amadahy Electric Ass Worship
https://img202.imagetwist.com/th/67162/2d192ql4ufn2.jpg (https://imagetwist.com/2d192ql4ufn2/xGGIbeS.jpg)
https://img202.imagetwist.com/th/67163/s7o9sf4lj9op.jpg (https://imagetwist.com/s7o9sf4lj9op/fTnunF.jpg)

Description:
ClubDom, In Our World Women Rule. Mistress Cheyenne has got her slave by the balls and isn_t going to let him off easy It_s ball busting time In Our World ..
Model:
Cheyenne Jewel, Goddess Amadahy
Studio:
Clubdom.com
Info:
File Name : cd_s505_cheyenne_jewel_amadahy_ass_lick.mp4
File Size : 603.49 MB
Resolution : 1920x1080
Duration : 00:06:58

Download K2S VIDEO:
Keep2Share Video: cd_s505_cheyenne_jewel_amadahy_ass_lick.mp4 (https://k2s.cc/file/6cec79c95d774)

Clit
02-05-2025, 07:09 AM
Clubdom.com- Alexis and Dahlia_s Boot Licker POV
https://s10.imagetwist.com/th/67148/yfjogwlj43sv.jpg (https://imagetwist.com/yfjogwlj43sv/wbVMxR.jpg)
https://img401.imagetwist.com/th/67148/lf9yutqc5xaa.jpg (https://imagetwist.com/lf9yutqc5xaa/HItkAi.jpg)

Description:
Goddesses Alexis Grace and Dahlia Rain have been tormenting their male pets all day long. This has caused the women to sweat and dirty their once very shiny and sexy boots. They have allowed you to come out of your cage and have given you the privilege of cleaning their boots for them, and be on your knees, staring up at their beauty while doing it. The catch? You will not be using rags, but your very own tongue. Get to work polishing just as the Goddesses tell you to. Do not miss one spot. Look at how horny this is making you. The Goddesses have noticed and want you to stroke your cock for them, and spray your man filth all over their boots, so they can enjoy watching you polish them all over again by licking off every drop.
Model:
Alexis Grace
Studio:
Clubdom.com
Info:
File Name : cd_s1016_dahilarain_alexisgrace_bootpov.mp4
File Size : 527.31 MB
Resolution : 1920x1080
Duration : 00:06:04

Download K2S VIDEO:
Keep2Share Video: cd_s1016_dahilarain_alexisgrace_bootpov.mp4 (https://k2s.cc/file/74980a3391c8d)

Clit
02-05-2025, 07:19 AM
Clubdom.com- Raven & Isobel Whipping 2
https://img401.imagetwist.com/th/67131/kiokes8m2pdi.jpg (https://imagetwist.com/kiokes8m2pdi/SRplJu.jpg)
https://img202.imagetwist.com/th/67131/bj85blmcxium.jpg (https://imagetwist.com/bj85blmcxium/XZshbv.jpg)

Description:
ClubDom, In Our World Women Rule. Mistress Cheyenne has got her slave by the balls and isn_t going to let him off easy It_s ball busting time In Our World ..
Model:
Isobel Devi, Raven Bay
Studio:
Clubdom.com
Info:
File Name : s920ravenisobelrickywhipping.mp4
File Size : 1010.69 MB
Resolution : 1920x1080
Duration : 00:10:03

Download K2S VIDEO:
Keep2Share Video: s920ravenisobelrickywhipping.mp4 (https://k2s.cc/file/dd2120d6b4118)

Clit
02-05-2025, 07:37 AM
Clubdom.com- Raven & Isobel Double StrapOn
https://img119.imagetwist.com/th/67133/i4up4l9hjmgz.jpg (https://imagetwist.com/i4up4l9hjmgz/XICcjqn.jpg)
https://img202.imagetwist.com/th/67133/hdkdl1d4006p.jpg (https://imagetwist.com/hdkdl1d4006p/xdmfNzdI.jpg)

Description:
ClubDom, In Our World Women Rule. Mistress Cheyenne has got her slave by the balls and isn_t going to let him off easy It_s ball busting time In Our World ..
Model:
Isobel Devi, Raven Bay
Studio:
Clubdom.com
Info:
File Name : s923ravenisobeldoublestrapon.mp4
File Size : 481.37 MB
Resolution : 1920x1080
Duration : 00:04:50

Download K2S VIDEO:
Keep2Share Video: s923ravenisobeldoublestrapon.mp4 (https://k2s.cc/file/f924b210d7261)

Clit
02-05-2025, 07:50 AM
Clubdom.com- Slave For Blondes Part 3- Cum Licking Fucker
https://img69.imagetwist.com/th/67137/onh0xtykcdum.jpg (https://imagetwist.com/onh0xtykcdum/ccOztWe.jpg)
https://img401.imagetwist.com/th/67137/6qw2m0r4i805.jpg (https://imagetwist.com/6qw2m0r4i805/tpIUsg.jpg)

Description:
The two hot blondes are not done with their sex slave. He must now fuck Mistress Parker with his hard injected cock. He pounds away with his hard cock into her inviting wet pussy while the two blondes dominate him. After the Mistresses are satisfied, he is milked onto her boots and forced to lick it off. He is so humiliated and used. He will make a fine sex slave for them.
Model:
Alexis Fawx, Parker Swayze
Studio:
Clubdom.com
Info:
File Name : cd_s951_3-3_alexisfawx_parkerswayze_bg2.mp4
File Size : 583.52 MB
Resolution : 1920x1080
Duration : 00:05:51

Download K2S VIDEO:
Keep2Share Video: cd_s951_3-3_alexisfawx_parkerswayze_bg2.mp4 (https://k2s.cc/file/26f48d208cf53)

Clit
02-05-2025, 08:02 AM
Clubdom.com- Jamie Valentine- Whipped by his Goddess
https://img166.imagetwist.com/th/67141/ivjuaontlgld.jpg (https://imagetwist.com/ivjuaontlgld/XLRVePV.jpg)
https://img69.imagetwist.com/th/67141/i7lkc25ev9xx.jpg (https://imagetwist.com/i7lkc25ev9xx/BUZAVO.jpg)

Description:
Jamie Valentine decides it is whipping day for her slave. He must endure everything she dishes out. she is determined to turn her white fleshy canvas, bright shades of red. She eats his flesh with a stinging galley whip as he cringes and groans. It_s too bad, there are no breaks here at Clubdom slave. He must continue to suffer More and more strikes she delivers. After a while, the laughing, smiling sadist switches to a black single tail, and she uses it with precision to deliver sharp blows to his back.
Model:
Jamie Valentine
Studio:
Clubdom.com
Info:
File Name : cd_s987_jamievalentine_whipping.mp4
File Size : 575.5 MB
Resolution : 1920x1080
Duration : 00:06:42

Download K2S VIDEO:
Keep2Share Video: cd_s987_jamievalentine_whipping.mp4 (https://k2s.cc/file/232b99683ca23)

Clit
02-05-2025, 08:03 AM
Clubdom.com- Raven & Isobel- Fuck-Table for Hot Young Mistresses
https://img34.imagetwist.com/th/67133/i1j3gz3iyxep.jpg (https://imagetwist.com/i1j3gz3iyxep/OTxkgbe.jpg)
https://img202.imagetwist.com/th/67133/hhnanjnxvjdc.jpg (https://imagetwist.com/hhnanjnxvjdc/xYfITi.jpg)

Description:
This slave better stay hard and please Mistress Raven or else Mistress Isobel is going to castrate him. There_s a catch: he_s not allowed to cum Mistress Ricky smothers the slave and keeps him excited while Raven pleasures herself on his huge hard dick. This slave_s huge hard dick is why these ladies keep him around as their fuck toy, after all. Raven gets wetter and wetter bouncing up and down on his cock making herself cum while Ricky smothers him with her beautiful young ass and pussy. They love controlling him, and his orgasm. Oh no It looks like he came.
Model:
Isobel Devi, Raven Bay
Studio:
Clubdom.com
Info:
File Name : s924ravenisobelfuckingtable.mp4
File Size : 315.09 MB
Resolution : 1920x1080
Duration : 00:03:10

Download K2S VIDEO:
Keep2Share Video: s924ravenisobelfuckingtable.mp4 (https://k2s.cc/file/6c3795125313a)

Clit
02-05-2025, 08:08 AM
Clubdom.com- Whipping Day with Harlow and Dahlia
https://img202.imagetwist.com/th/67154/noyp1wpkh3b4.jpg (https://imagetwist.com/noyp1wpkh3b4/qdQsyk.jpg)
https://img119.imagetwist.com/th/67154/yh85ti5u5zbr.jpg (https://imagetwist.com/yh85ti5u5zbr/GfOTHS.jpg)

Description:
Goddess Harlow and Goddess Dahlia have their slave strung up for a whipping. It is whipping day, and they have chosen this slave to be shredded by their vicious whips. You are really going to get it says Dahlia, smiling with sadistic glee. The women take turns shredding their slave_s back with their whips, mocking him and treating him like the piece of meat that he is. It_s the only way to keep their slaves in line, they all must be regularly whipped on whipping day.
Model:
Dahlia Rain, Harlow Harrison
Studio:
Clubdom.com
Info:
File Name : cd_s1061_dahliaharlow_whip.mp4
File Size : 681.41 MB
Resolution : 1920x1080
Duration : 00:07:53

Download K2S VIDEO:
Keep2Share Video: cd_s1061_dahliaharlow_whip.mp4 (https://k2s.cc/file/1f7f001c17376)

Clit
02-05-2025, 08:10 AM
Clubdom.com- Inga Victoria- Pussy For Dinner Part 1
https://img202.imagetwist.com/th/67134/rv2j7gojk80s.jpg (https://imagetwist.com/rv2j7gojk80s/RimXCADp.jpg)
https://s10.imagetwist.com/th/67135/1meo3invxgoa.jpg (https://imagetwist.com/1meo3invxgoa/EpxTSUtR.jpg)

Description:
Inga Victoria has been using this slave for her pleasure despite him being starving and worked hard at her house for 3 days doing yard work He now must work very hard...fucking her until she is good and satisfied. Normally she keeps him in chastity but she hasn_t lately as he is now afraid to even get a hard-on unless she commands it. Now he has full permission to be inside of her. Such a thrill fucking such a powerful woman and feeling her body. After she is done, she commands him to cum on her tits....and lick it ALL off. A moment later, She is eating a very large plate of food, but she will not share. He had his chance earlier and he had chose her pussy over food. Now he gets nothing but his own filth.
Model:
Inga Victoria
Studio:
Clubdom.com
Info:
File Name : s9471-3ingavictoriapussyeat.mp4
File Size : 836.2 MB
Resolution : 1920x1080
Duration : 00:08:21

Download K2S VIDEO:
Keep2Share Video: s9471-3ingavictoriapussyeat.mp4 (https://k2s.cc/file/b14a31ac591c3)

Clit
02-05-2025, 08:26 AM
Clubdom.com- Dava Foxx- Stroking Your Slut Stick
https://img202.imagetwist.com/th/67127/4s0pqatpo2w3.jpg (https://imagetwist.com/4s0pqatpo2w3/WEiCta.jpg)
https://img119.imagetwist.com/th/67127/sk1olxmyxnp2.jpg (https://imagetwist.com/sk1olxmyxnp2/webzQkI.jpg)

Description:
Goddess Dava FoXX knows what a horny little slut you are and loves teasing you and bringing you right to the edge as she allows you to stroke your tiny pathetic slut stick as she drives you crazy showing your her tits and pussy telling you how you could never please a woman like her, Nut go ahead and spill your filth bitch boy, just remember to lick up every last drop.
Model:
Dava Foxx
Studio:
Clubdom.com
Info:
File Name : s862davafoxxpov2.mp4
File Size : 580.75 MB
Resolution : 1920x1080
Duration : 00:06:43

Download K2S VIDEO:
Keep2Share Video: s862davafoxxpov2.mp4 (https://k2s.cc/file/23c3579258ea8)

Clit
02-05-2025, 08:27 AM
Clubdom.com- Rikki Rumor & Jade Caning
https://img119.imagetwist.com/th/67130/xzxjbvdv4vo3.jpg (https://imagetwist.com/xzxjbvdv4vo3/nBQiZjb.jpg)
https://s10.imagetwist.com/th/67130/c11sa43j2yl6.jpg (https://imagetwist.com/c11sa43j2yl6/zTWMVO.jpg)

Description:
ClubDom, In Our World Women Rule. Mistress Cheyenne has got her slave by the balls and isn_t going to let him off easy It_s ball busting time In Our World ..
Model:
Jade Jantzen, Rikki Rumor
Studio:
Clubdom.com
Info:
File Name : s930rikkirumorjadejantzencaningwhipping.mp4
File Size : 488.69 MB
Resolution : 1920x1080
Duration : 00:05:42

Download K2S VIDEO:
Keep2Share Video: s930rikkirumorjadejantzencaningwhipping.mp4 (https://k2s.cc/file/556f86365ac4a)

Clit
02-05-2025, 08:29 AM
Clubdom.com- Raven & Isobel- Surprise Sucker-Punch
https://img401.imagetwist.com/th/67136/64i3glts1iel.jpg (https://imagetwist.com/64i3glts1iel/XvdEsR.jpg)
https://img119.imagetwist.com/th/67136/4ixactyip5ay.jpg (https://imagetwist.com/4ixactyip5ay/BeWRQLn.jpg)

Description:
Mistress Isobel and Mistress Raven have slave Bart right where they want him. He is saran-wrapped to the CBT chair as the girls punch him, poke him and tell him that he has to do everything they say in order to get milked. He agrees and is stroked by Raven while Isobel slaps him around, chokes him, and teases him with Raven_s gorgeous breasts. Slave Bart thinks he is in for a real treat as he cums all over until Isobel punches him repeatedly in his nuts and ruins his orgasm. (She punches him SO HARD, that when the camera cut out, slave Bart actually had fainted. You can actually see him about to completely pass out, face sweating, blinking his eyes unable to see).The girls laugh about his demise afterwards.
Model:
Isobel Devi, Raven Bay
Studio:
Clubdom.com
Info:
File Name : s925ravenisobelhandjobballbust.mp4
File Size : 947.73 MB
Resolution : 1920x1080
Duration : 00:09:28

Download K2S VIDEO:
Keep2Share Video: s925ravenisobelhandjobballbust.mp4 (https://k2s.cc/file/43a0880135d9f)

Clit
02-05-2025, 08:36 AM
Clubdom.com- Alexia Fawx & Michelle Lacy- Sweaty Ass Sniffer Cum-Face
https://img34.imagetwist.com/th/67127/1midqte9wv20.jpg (https://imagetwist.com/1midqte9wv20/pjFdBqc.jpg)
https://img119.imagetwist.com/th/67127/rja2ygv5a6vz.jpg (https://imagetwist.com/rja2ygv5a6vz/saGpdO.jpg)

Description:
Goddess Michelle Lacy and Alexis Fawx pull their slave from his cage blind folded and decide to have some fun with him letting him smell their pussies and sweaty ass asking him if he would like one lick, Then laughing at his 2 inch stiffy making him jerk it off into the collection cup that is filled ith a months worth of slave filth, then letting him add his tiny pathetic load to the cup, they dump it all over his face making him lick it up and asking him how much he enjoys being a cum face.
Model:
Alexis Fawx, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s868alexisfawxmechellelacycumface.mp4
File Size : 626.56 MB
Resolution : 1920x1080
Duration : 00:07:21

Download K2S VIDEO:
Keep2Share Video: s868alexisfawxmechellelacycumface.mp4 (https://k2s.cc/file/e20a705b84a53)

Clit
02-05-2025, 08:41 AM
Clubdom.com- Cock Slut For Goddesses
https://img401.imagetwist.com/th/67154/5hry4o8h1929.jpg (https://imagetwist.com/5hry4o8h1929/tqKwzKvs.jpg)
https://img34.imagetwist.com/th/67154/cksws6axpsig.jpg (https://imagetwist.com/cksws6axpsig/QryMEx.jpg)

Description:
Kneel before your beautiful sexy Goddesses and open wide. It_s time for all of your slut training to pay off. Show your Goddesses how you can handle their huge cocks inside your slut-holes. Take every inch into your mouth and your ass. Spread your ass so they can see their gaping target, and take all of their superior cocks into yourself and feel what it is to be truly fucked and over-powered by hot Goddesses.m
Model:
Dahlia Rain
Studio:
Clubdom.com
Info:
File Name : cd_s1060_dahliaharlow_strappov.mp4
File Size : 426.54 MB
Resolution : 1920x1080
Duration : 00:05:01

Download K2S VIDEO:
Keep2Share Video: cd_s1060_dahliaharlow_strappov.mp4 (https://k2s.cc/file/15e6ae6d11328)

Clit
02-05-2025, 08:57 AM
Clubdom.com- Goddess Vivian Disgusting Slut Sacks
https://img401.imagetwist.com/th/67165/tql8f09qhweb.jpg (https://imagetwist.com/tql8f09qhweb/MToKGnuY.jpg)
https://img119.imagetwist.com/th/67165/1rckd0inbf8g.jpg (https://imagetwist.com/1rckd0inbf8g/xpzlhDY.jpg)

Description:
Goddess Vivian Leigh is sick of her slave_s disgusting slut sacks. She tells her slave that today is the day she will destroy his disgusting balls. Goddess Vivian Leigh kicks and punches his pathetic balls until they are completely destroyed.
Model:
Vivian Leigh
Studio:
Clubdom.com
Info:
File Name : cd_s1115_goddessvivianleigh_ballbust.mp4
File Size : 609.55 MB
Resolution : 1920x1080
Duration : 00:07:04

Download K2S VIDEO:
Keep2Share Video: cd_s1115_goddessvivianleigh_ballbust.mp4 (https://k2s.cc/file/b39e7170955e6)

Clit
02-05-2025, 08:58 AM
Clubdom.com- Harlow Harrison Whipping
https://img69.imagetwist.com/th/67166/5wn90r9se7d5.jpg (https://imagetwist.com/5wn90r9se7d5/IgjZjiWf.jpg)
https://img202.imagetwist.com/th/67166/yy8bld5vl0oc.jpg (https://imagetwist.com/yy8bld5vl0oc/CPVYotl.jpg)

Description:
Goddess Harlow Harrison likes to be artistic, but doesn_t like to use paintbrushes. Instead, she_s found that her art of choice is leaving bright red lines from her leather whip on her slaves back. She has her slave caught by his balls while she starts whipping his back. Goddess Harlow is happy with her whipping art.
Model:
Harlow Harrison
Studio:
Clubdom.com
Info:
File Name : cd_s1109_harlowharrison_whipping.mp4
File Size : 674.43 MB
Resolution : 1920x1080
Duration : 00:07:51

Download K2S VIDEO:
Keep2Share Video: cd_s1109_harlowharrison_whipping.mp4 (https://k2s.cc/file/49fa42ff15acf)

Clit
02-05-2025, 09:00 AM
Clubdom.com- Lexi & Kelly Chindo
https://img119.imagetwist.com/th/67144/9ss1s8lbcnli.jpg (https://imagetwist.com/9ss1s8lbcnli/XeoBsIU.jpg)
https://img34.imagetwist.com/th/67144/7u95bpo380be.jpg (https://imagetwist.com/7u95bpo380be/ArTtvQ.jpg)

Description:
ClubDom, In Our World Women Rule. Mistress Cheyenne has got her slave by the balls and isn_t going to let him off easy It_s ball busting time In Our World ..
Model:
Kelly Paige, Lexi Luna
Studio:
Clubdom.com
Info:
File Name : cd_s995_lexiluna_kellypaige_chindo.mp4
File Size : 605.96 MB
Resolution : 1920x1080
Duration : 00:07:00

Download K2S VIDEO:
Keep2Share Video: cd_s995_lexiluna_kellypaige_chindo.mp4 (https://k2s.cc/file/074d4d8ee581f)

Clit
02-05-2025, 09:18 AM
Clubdom.com- Fuck Puppet For Rubber Girl-Gang
https://s10.imagetwist.com/th/67138/8q6h8dsl6kxg.jpg (https://imagetwist.com/8q6h8dsl6kxg/JWCcikjV.jpg)
https://img119.imagetwist.com/th/67138/sizoqylyugsk.jpg (https://imagetwist.com/sizoqylyugsk/ZmnKIXp.jpg)

Description:
Slave 013 has to be trained orally and anally by the gang of rubber vixens. Michelle Lacy. Natalya Sadici, Lydia Supremacy and Lynn Pops all surround and intimidate him. He is forced to suck their huge cocks and take them deep into his man pussy. Michelle Lacy pounds this slut hard and does not let him have any mercy while Lynn stuffs his mouth. Natalya and Lydia watch on, each one threatening him if he doesn_t do a good job...
Model:
Lydia Supremacy, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : cd_s958_michellelacy_lydiasupremacy_natalya_lynnpo ps_strapon.mp4
File Size : 531.39 MB
Resolution : 1920x1080
Duration : 00:06:09

Download K2S VIDEO:
Keep2Share Video: cd_s958_michellelacy_lydiasupremacy_natalya_lynnpo ps_strapon.mp4 (https://k2s.cc/file/a63df48a0c2ed)

Clit
02-05-2025, 09:41 AM
Clubdom.com- Jamie Valentine & Olivia Monkey Fist
https://img401.imagetwist.com/th/67145/v7ge1cmpd3pf.jpg (https://imagetwist.com/v7ge1cmpd3pf/oZvIWrKT.jpg)
https://img166.imagetwist.com/th/67146/6jl4ospf9cva.jpg (https://imagetwist.com/6jl4ospf9cva/VqsHaxv.jpg)

Description:
Guardesses Jamie Valentine and Olivia Fox decide that they are going to play some ball games with their prisoner. They stand menacingly outside his cage, swinging their monkey fist rope knots, planning to swing them straight into the slave_s balls. Jamie lights up a cigarette and blows it right into his face. He is in a straight jacket and cannot move anywhere, which is just the way the women prefer. Strung up, arms bound in the jacket, with no way to protect his balls, the women grin, and laugh, and begin to swing....
Model:
Jamie Valentine, Olivia Fox
Studio:
Clubdom.com
Info:
File Name : cd_s1011_2-5_jamievalentine_oliviafox_monkeyfist.mp4
File Size : 578.11 MB
Resolution : 1920x1080
Duration : 00:06:43

Download K2S VIDEO:
Keep2Share Video: cd_s1011_2-5_jamievalentine_oliviafox_monkeyfist.mp4 (https://k2s.cc/file/f25b5fdec4683)

Clit
02-05-2025, 09:42 AM
Clubdom.com- Arena StrapOn Fucks his Man-Pussy
https://img166.imagetwist.com/th/67169/rkhrsrudq3kg.jpg (https://imagetwist.com/rkhrsrudq3kg/pPCRyin.jpg)
https://img401.imagetwist.com/th/67169/uvazh60epx9c.jpg (https://imagetwist.com/uvazh60epx9c/czgGSTB.jpg)

Description:
Queen Arena Rome makes her slave lube up her strap on before she fucks his tight man pussy. When her big black cock is lubed up enough, Queen Arena bends her slave over and shoves her cock in his ass.
Model:
Arena Rome
Studio:
Clubdom.com
Info:
File Name : cd_s1110_5-5_arenarome_strapon.mp4
File Size : 541.31 MB
Resolution : 1920x1080
Duration : 00:06:17

Download K2S VIDEO:
Keep2Share Video: cd_s1110_5-5_arenarome_strapon.mp4 (https://k2s.cc/file/fb1a900eec032)